[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fabH6
DDBJ      :fabH6        putative 3-oxoacyl-ACP synthase III
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->333 2aj9A PDBj 2e-15 31.2 %
:RPS:PDB   46->332 1b65A PDBj 3e-18 8.9 %
:RPS:SCOP  9->170 1eblA1  c.95.1.2 * 5e-17 26.9 %
:RPS:SCOP  211->332 1u0mA2  c.95.1.2 * 3e-08 15.3 %
:HMM:SCOP  4->333 1tedA_ c.95.1.2 * 2.3e-21 21.8 %
:RPS:PFM   114->172 PF08392 * FAE1_CUT1_RppA 3e-04 35.6 %
:RPS:PFM   251->333 PF08541 * ACP_syn_III_C 2e-05 30.5 %
:HMM:PFM   243->333 PF08541 * ACP_syn_III_C 1e-19 33.3 90/90  
:HMM:PFM   108->186 PF08545 * ACP_syn_III 3.7e-15 26.9 78/80  
:HMM:PFM   20->34 PF00681 * Plectin 0.00096 53.3 15/45  
:BLT:SWISS 46->337 FABH_MYCA9 3e-17 31.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68537.1 GT:GENE fabH6 GT:PRODUCT putative 3-oxoacyl-ACP synthase III GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 978292..979311 GB:FROM 978292 GB:TO 979311 GB:DIRECTION + GB:GENE fabH6 GB:PRODUCT putative 3-oxoacyl-ACP synthase III GB:NOTE PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal GB:PROTEIN_ID BAC68537.1 LENGTH 339 SQ:AASEQ MKFTNDLYIASAASWLPDVVSVDEAIAAGLVDDEHRNLGYESIAVADGVAGPEMAVRAGRLALERAVGIERDEVGLVLHSSCGFQGHEMWPAAAYVANETVGPAAPGFDLQQRCNAGLGSLCLAAGYVDAGFTSAVLLTTGDNFAPPWVDRWNVQLNFIFADGGTALVLSGRQGFARVVSATLGADNSLERWNRGTAPFATAPGLEMPLPLRERGLQHAVTPEAEGSWERYEAALMDTTRRALSEAQVGVEDISRVVMPLIHRGVSPENYELLGFTEKQSTWDLGRLVGHVAAGDQFLGLEHLVKQGTVGPGDLVLLVAAGEGFSYSAAVVEILDVPSW GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 46->337|FABH_MYCA9|3e-17|31.7|278/340| BL:PDB:NREP 1 BL:PDB:REP 46->333|2aj9A|2e-15|31.2|272/334| RP:PDB:NREP 1 RP:PDB:REP 46->332|1b65A|3e-18|8.9|270/363| RP:PFM:NREP 2 RP:PFM:REP 114->172|PF08392|3e-04|35.6|59/290|FAE1_CUT1_RppA| RP:PFM:REP 251->333|PF08541|2e-05|30.5|82/90|ACP_syn_III_C| HM:PFM:NREP 3 HM:PFM:REP 243->333|PF08541|1e-19|33.3|90/90|ACP_syn_III_C| HM:PFM:REP 108->186|PF08545|3.7e-15|26.9|78/80|ACP_syn_III| HM:PFM:REP 20->34|PF00681|0.00096|53.3|15/45|Plectin| GO:PFM:NREP 5 GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF08392|IPR013601| GO:PFM GO:0016020|"GO:membrane"|PF08392|IPR013601| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF08392|IPR013601| GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF08541|IPR013747| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF08541|IPR013747| RP:SCP:NREP 2 RP:SCP:REP 9->170|1eblA1|5e-17|26.9|156/174|c.95.1.2| RP:SCP:REP 211->332|1u0mA2|3e-08|15.3|118/148|c.95.1.2| HM:SCP:REP 4->333|1tedA_|2.3e-21|21.8|316/0|c.95.1.2|1/1|Thiolase-like| OP:NHOMO 51 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- --1-----------1--11-1---1-11111------11--112----------------1----114111---------------------------------------11111-11-1-----------------11------1-------------------1----------------------1------------------------------------------------------------------------------------------------------------------------------------------1----------------------------11-----1------------------------------------------------------1------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------1-11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 98.2 SQ:SECSTR #####cEEEEEEEEEcccEEEEHHHHTTcccccHHHHHHHHcccccccEEEEEEEETTTTccccccTEEEEEEEEEEccccccHHccccHHHHHcEEcccEEEEEGGGHHHHHHHHHHHHHHHTHHHHccccccccccEEEEEccTTTccGGGccccHHHHHHHHHTcccccccccccccEEEEcGGGGGGTTcEETTEEcEEEEEEEEHEEETTEEEEEEEEEEEccccGGGcccTccHHHHccTTcHHHHccEEEEEEEcccccHHHHHHHHHTHHHHHHTTTcHcccTTcEEEEEEEEcccccccGGccccccccccccGHHHHHHHHHcccccc# DISOP:02AL 1-3, 338-339| PSIPRED cccccccEEEEEEEEcccccccHHHHHHcccccHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHccEEEEEEcccccccccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHccccccccHHHHHHHHHccEEEEEEEcccccccEEEEEEEccccHHHEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEEEEcccccc //