[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fadC6
DDBJ      :fadC6        putative 3-hydroxyacyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  425/915 : Eukaryota  109/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->228 3f3sB PDBj 2e-20 30.8 %
:RPS:PDB   9->310 2dpoA PDBj 3e-23 25.8 %
:RPS:SCOP  4->182 2b0jA2  c.2.1.6 * 1e-12 9.6 %
:RPS:SCOP  188->288 1f0yA1  a.100.1.3 * 9e-07 14.0 %
:HMM:SCOP  4->186 1f0yA2 c.2.1.6 * 9.3e-53 33.9 %
:HMM:SCOP  188->294 1f0yA1 a.100.1.3 * 6.1e-13 29.3 %
:RPS:PFM   9->183 PF02737 * 3HCDH_N 3e-17 33.3 %
:HMM:PFM   9->183 PF02737 * 3HCDH_N 1.2e-50 37.4 174/180  
:HMM:PFM   188->259 PF00725 * 3HCDH 4e-14 31.9 72/97  
:BLT:SWISS 9->210 HBD_CLOAB 2e-21 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68426.1 GT:GENE fadC6 GT:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(868691..869677) GB:FROM 868691 GB:TO 869677 GB:DIRECTION - GB:GENE fadC6 GB:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GB:NOTE PF02737: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain GB:PROTEIN_ID BAC68426.1 LENGTH 328 SQ:AASEQ MNVHTPVHRVAIVGTGTIGASWATHYLVRGFDVTATDPGPTAETALRSYVEAAWDAAASIGLAPEASPDRLSFTADLRQAVADADFVQENAPERPELKVKLFADIDDATPPDAIIASSSSGITMSVIQAECRRPERTVIGHPFNPPHIVPLVEVVGGTRTAPETIRDVMSFYAAIGKKPIHLKKELPGHVANRIQAALYREVVYLVQEGVLDVADSDDAVSWGPGLRWGVMGPHLLWHLGGGEGGIQHFMDTLMPRMVASWQELGIPEFTPELKEEIVGGVLEEAGGRSVDELAARRDAMLSALLAVRAQHDPSGPSATAGRGPKEEA GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 9->210|HBD_CLOAB|2e-21|31.0|200/282| SEG 103->116|adiddatppdaiia| SEG 212->221|dvadsddavs| SEG 232->248|gphllwhlgggeggiqh| BL:PDB:NREP 1 BL:PDB:REP 21->228|3f3sB|2e-20|30.8|208/311| RP:PDB:NREP 1 RP:PDB:REP 9->310|2dpoA|3e-23|25.8|299/310| RP:PFM:NREP 1 RP:PFM:REP 9->183|PF02737|3e-17|33.3|174/180|3HCDH_N| HM:PFM:NREP 2 HM:PFM:REP 9->183|PF02737|1.2e-50|37.4|174/180|3HCDH_N| HM:PFM:REP 188->259|PF00725|4e-14|31.9|72/97|3HCDH| GO:PFM:NREP 2 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| RP:SCP:NREP 2 RP:SCP:REP 4->182|2b0jA2|1e-12|9.6|177/242|c.2.1.6| RP:SCP:REP 188->288|1f0yA1|9e-07|14.0|93/99|a.100.1.3| HM:SCP:REP 4->186|1f0yA2|9.3e-53|33.9|183/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 188->294|1f0yA1|6.1e-13|29.3|99/99|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1161 OP:NHOMOORG 566 OP:PATTERN 11-1--4655655544-111121A3221--12-----------------------------2221-11 13224--2--1-1-61222-221114222221121222241-111112-211323423--333-2245662-----111---2----------------2-121132112----------------------------------2------------------------1-------------11122---121111111122112111131121111233121-------311--------------111-1--1----1----------1-------111------------------------------------------11121111111112-1222111-1-112-1--441313-23---1--1-1--4222-----225432122232-22222211223-11411623541-22212221111133-1-1122122224--------2----221-------------------------------151-2774344433422222554422221463B3851134413322232-223-------12----------5221733-1---------232-4-11-11-12211---------------------------11---1--12-1222222-111221-121----12--------1-11---2111211-21-1121---2111-1--2--1111111-1----------------4---1111--1--------------1------112--221---------------44424221--4-12124442254572112111111111-1111111111111111-------1------11--------------1---------------------------------------- ----112-1---221122-3222443311--------111111-1-1-113213--2--222------------------------------2---2222---111-34-7542221--11-3321-416H2-321----2-112121--1-13-32-3362-5321213-234--1------1-324212111221-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 306 STR:RPRED 93.3 SQ:SECSTR #cccGGGcEEEEEcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHHHHHHHHHHTTccHHHHHHTEEEEccHHHHTTTEEEEEEcccccHHHHHHHHHHHHTTcccccEEEEccccccHHHHHTTcTTGGGEEEEEEcccTTTccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEcccccTTTTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHTTHHHHHTTc###cHHHHHHHTTTcHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHH################## DISOP:02AL 1-3, 308-328| PSIPRED ccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHcccccEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccHHHHHHcccccHHHHHHHHHHcccccccccccccccccc //