[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fadD6
DDBJ      :fadD6        putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  648/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:516 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->510 2vzeA PDBj 4e-29 27.9 %
:RPS:PDB   5->508 3dlpX PDBj 5e-52 21.3 %
:RPS:SCOP  8->510 1md9A  e.23.1.1 * 8e-52 22.2 %
:HMM:SCOP  3->511 1pg4A_ e.23.1.1 * 1.2e-128 33.8 %
:RPS:PFM   30->422 PF00501 * AMP-binding 4e-43 36.3 %
:HMM:PFM   32->435 PF00501 * AMP-binding 5.2e-79 31.7 397/418  
:BLT:SWISS 30->506 LCFB_BACSU 2e-43 29.5 %
:PROS 161->172|PS00455|AMP_BINDING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68969.1 GT:GENE fadD6 GT:PRODUCT putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1562796..1564346) GB:FROM 1562796 GB:TO 1564346 GB:DIRECTION - GB:GENE fadD6 GB:PRODUCT putative acyl-CoA synthetase, long-chain fatty acid:CoA ligase GB:NOTE PF00501: AMP-binding enzyme GB:PROTEIN_ID BAC68969.1 LENGTH 516 SQ:AASEQ MSVPPNGFWSQAAADPERTVLIAPDGEEWTAGRLHASVNRLVHGLRAAGLERGDAFAVVLPNGVEFFTAYLAASQAGLYLVPVNHHLVGPEIAWIVADSGAKVLIAHERFADSARHAADEAKLPAEQRYAVGAIDGFRPYAELLDGQPGSAPADRTLGWVMNYTSGTTGRPRGIRRPLPGKLPEETYLGGFLGIFGIKPFEGNVHLVCSPLYHTAVLQFAGASLHIGHRLVLMDKWTPEEMLRLIDTHRCTHTHMVPTQFHRLLALPEEVKGRYDVSSMRHAIHGAAPCPDHVKRAMITWWGDSVEEYYAASEGGGAFATAEDWLKKPGTVGKAWPISELAIFDDEGNRLPAGELGTVYMKMSTGGFSYHKDEAKTKKNRIGDFFTVGDLGCLDEEGYLFLRDRKIDMIISGGVNIYPAEIEAALLAHPAVADAAAFGIPHDDWGEEVKAVVEPAPGHDPGPALAADILGHCEQRLAGYKRPKSVDFIETMPRDPNGKLYKRRLRDPYWEGRTRKV GT:EXON 1|1-516:0| BL:SWS:NREP 1 BL:SWS:REP 30->506|LCFB_BACSU|2e-43|29.5|461/513| PROS 161->172|PS00455|AMP_BINDING|PDOC00427| SEG 166->183|gttgrprgirrplpgklp| SEG 423->436|aallahpavadaaa| BL:PDB:NREP 1 BL:PDB:REP 47->510|2vzeA|4e-29|27.9|444/533| RP:PDB:NREP 1 RP:PDB:REP 5->508|3dlpX|5e-52|21.3|492/504| RP:PFM:NREP 1 RP:PFM:REP 30->422|PF00501|4e-43|36.3|383/405|AMP-binding| HM:PFM:NREP 1 HM:PFM:REP 32->435|PF00501|5.2e-79|31.7|397/418|AMP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 8->510|1md9A|8e-52|22.2|490/536|e.23.1.1| HM:SCP:REP 3->511|1pg4A_|1.2e-128|33.8|503/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 5751 OP:NHOMOORG 880 OP:PATTERN 33-2--6DFEFFEEC8--64542I955321593231--222217646934433--------132---- 1365J53222284AJgNFF-FR55PXEEEEEFUVbVPlzv-L7R2-11165-626534--B8G1DBQI9G5--------375D113212222-2--1---1---11-111---------------11-31111111999CD222A831243321111---21-22153152---1-----1--54466--1D89BBBBB9AC8CACAAA78AA8ABCA9IDAB45333333A3244444444444444522351-1-11-1-----1111-1-122222---1-------------------------------11---11111---21111111-1-5-11------4--81-5-A72251--B31111---421HAAF-----23TPT535UIVPL12221121224-98C98H8A8CH-533545655A66AB67597B475598F--------A--12985-----------------------------1EEWD-4GG8EDEFHHE7999799CLCCCC8CL9SRegW23FF78A899N8EJOL1171111632222222323B773gJ75565356445-2732624334574A488-111-----------------11131145-562625534333336644434454367--12641------53434335555566654-456555656656655555464732142534456555654544542334444--222222122121---4---1-332113732111111-111-111266776467975279887C7778787743422222323211334222222211222222222221212------------------1-------------------------------------11- ----681-1---346DF9BC7AABBFD887847775BC7BACD999856768AB88A466664111-11-111-11111111111111-7G8F9792223526A38-273C1725384112352E9263Dc8-87A6432633533332-71-E4534BA858D7E8FBOE699D1124K23372FIFk8RI42C7B66 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 508 STR:RPRED 98.4 SQ:SECSTR ####HHHHHHHHHHcTTcEEEEETTTTEEEHHHHHHHHHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHTTccEEEEcccHHHHHHHHTcccccEEEEHHHHEETTEEccccccccccccccccTTcEEEEEEEEcccccccEEEEEEGGGHHHHHHHHHHHHHTTcccccTTcEEEEcccTTcHTTHHTHHHHHHTTcEEEEcccccHHHHHHHHHHTTccEEEccHHHHHHHHHHHHHccTTcccTTccEEEEccTTccHHHHHHHHHHcccEEEEEEEETTTEEEEEEEccccTTEEcccTTccEEEEcTTccTTccccccccEEEEEEccTTccccTTcHHHHHHHEETTEEEEEEEEEEcTTccEEEEEETTTcEEETTEEEcHHHHHHHHTTcTTEEEEEEEEEEcccccEEEEEEEEEcTTccccccHHHHHHHHHHccccGGGcccEEEEcccccccccccccTTHHHHHHTcHc#### DISOP:02AL 511-514| PSIPRED ccccHHHHHHHHHHccccEEEEEccccEEcHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHcccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEccHHHHHHHHHccHHHHHccccccEEEEEEccccccHHHHHHHHHHcccEEEEccccHHHcccccccccHHHcccccccccccEEEEEEcccccccccccEEEEEEEcccccHHHcccHHHHHHHHHcccEEEccEEEEccccEEEEEEEEEEEEEEccEEEcHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHccc //