[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fecB
DDBJ      :fecB         putative ABC transporter iron(III)/siderophore-binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->347 3be6A PDBj 4e-37 14.8 %
:RPS:SCOP  62->342 1efdN  c.92.2.1 * 1e-28 15.5 %
:HMM:SCOP  62->346 1n2zA_ c.92.2.2 * 5.1e-35 29.6 %
:RPS:PFM   73->324 PF01497 * Peripla_BP_2 7e-11 28.5 %
:HMM:PFM   77->321 PF01497 * Peripla_BP_2 6e-31 24.2 223/238  
:BLT:SWISS 46->347 YVRC_BACSU 7e-07 24.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68312.1 GT:GENE fecB GT:PRODUCT putative ABC transporter iron(III)/siderophore-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(753242..754285) GB:FROM 753242 GB:TO 754285 GB:DIRECTION - GB:GENE fecB GB:PRODUCT putative ABC transporter iron(III)/siderophore-binding protein GB:NOTE fhuD, PF01497: Periplasmic binding protein GB:PROTEIN_ID BAC68312.1 LENGTH 347 SQ:AASEQ MSKKRPVAVALAGALCLVTAACADSSTDQDGATGDKASAAAAKSGYPAILENCGVSEKFTKAPGRVVVMNGASVAEVSTLLSLGLGDRVVANQQSYGMSEVPGRAKAIKALPNGKVKLNDAYDIPREAMIGLRPDLVLSTTSYGFDEKNGFATRDQLKEVGAHTYVSPQGCDQDTSKMTVADSYTLLRDMGKIFNVRDRAEQLIAASEKHIAEISAKVKGEKQPKVMVLFSNMAMGGNDFSSVVAKGIYNDILAKAGGSNAFASASKTSFADLSKEKVAATDVDALVVIGYNDPNPAAYAKKLLKEFPQWPAAKNNTYVALSDSMYLGPSNDLAVEKIAKALHPDKF GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 46->347|YVRC_BACSU|7e-07|24.4|266/314| SEG 7->23|vavalagalclvtaaca| SEG 30->44|dgatgdkasaaaaks| RP:PDB:NREP 1 RP:PDB:REP 53->347|3be6A|4e-37|14.8|270/289| RP:PFM:NREP 1 RP:PFM:REP 73->324|PF01497|7e-11|28.5|228/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 77->321|PF01497|6e-31|24.2|223/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 62->342|1efdN|1e-28|15.5|252/262|c.92.2.1| HM:SCP:REP 62->346|1n2zA_|5.1e-35|29.6|243/0|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 161 OP:NHOMOORG 125 OP:PATTERN ---------------------11----------------------2---------1-1---------- ------11111-2-1------1---3----------1413-11-1-1-112------1---1-2321124--------------------------------------------------------------------------1----------------------2-----------------1-----------------------------------2---------21----------------------------------------------------------------------------------------------11111121111----111-1-----1------------------1--------------------------11111111111-------1--1--122111-222-1-----1-21-1111----------11----1----------------------------------------------1--------------1----------------1-1----------1----------1---------------------------------------------------------------------------------------------------------31-1-1--------1----------------------11211-------------------2--------------------------------------1---------------------------1111111211111-222---------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 297 STR:RPRED 85.6 SQ:SECSTR ############################################ccEEEEcTTccEEEEEcccccEEEccTTTTHH#HHHHHTTccccEEccEEcTTccEETHHHHHcccGGGcccEEcccccccHHHHHHTcccEEEEcTTccTT####GccHHHHHHHccEEEccTTTccccccccTTTHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHccGGGGccEEEEEEET#EEETTEEEEcccHHHHHHHHHTTccccHHHTccTTcEEEcGGGGGGGcccEEEEEEccTTcccTHHHHHHHHTTGGHHHHTTcEEEEEHHHHHcHHHHHHHHHHHHHHHcccc DISOP:02AL 1-3, 22-44| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccEEEEcccccEEEEEcccHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHccccccccccccccccHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccEEEccccHHHHHHHHHcccccHHHccccccccccHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccHHHcccEEEEcccccccccHHHHHHHHHHHHccccc //