[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fprB
DDBJ      :fprB         putative NADPH-ferredoxin reductase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  189/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.114.1c.3.1c.4.1
:448 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->432 1lqtB PDBj 2e-75 43.1 %
:RPS:PDB   3->432 1e6eC PDBj 1e-11 33.9 %
:RPS:SCOP  1->126 2hy5B1  c.114.1.1 * 2e-15 14.2 %
:RPS:SCOP  103->138 1cjcA1  c.3.1.1 * 3e-04 44.4 %
:RPS:SCOP  271->315 1gt8A3  c.3.1.1 * 2e-04 28.9 %
:HMM:SCOP  2->316 1lqtA2 c.4.1.1 * 3.8e-51 40.5 %
:HMM:PFM   4->207 PF07992 * Pyr_redox_2 4.7e-12 25.4 142/202  
:BLT:SWISS 3->432 FPRA_MYCTU 2e-74 42.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69217.1 GT:GENE fprB GT:PRODUCT putative NADPH-ferredoxin reductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1847273..1848619 GB:FROM 1847273 GB:TO 1848619 GB:DIRECTION + GB:GENE fprB GB:PRODUCT putative NADPH-ferredoxin reductase GB:NOTE PF00070: Pyridine nucleotide-disulphide oxidoreductase GB:PROTEIN_ID BAC69217.1 LENGTH 448 SQ:AASEQ MLHVAVVGSGPSGVYTAQGLVQQDSGVRVDVLDRLPCPYGLVRYGVAPDHEKIKSLQNNLRTVLEHERVRFLGGVRIGPDGVPATRLRELYHAVVYCVGAATDRHLGIPGEELPGSWSATEFVSWYSAHPDSVADGFVRGARSAVVIGVGNVAVDVTRILARGPSELSPTDMPQAALTALAASRVTDIHMVGRRGPSQARFTTKELRELGALPDTDVVVDQRELALDPAYADPSGLPAAQRRNVEVLRAWAEAPPKGAPRRIRPRFFLRPVELLDGGGHVGAVRFERTAPDGRGGVAGTGQYEDIEAQLVLRSVGYRGVPLEGLPFDAEQGTVPHLAGRVLRDGAVSPGEYVAGWIKRGPTGVIGTNRPCAKETVTSLLADAPVLVRREVPDDPMAVLRAEGLRPVEWAGWQAIERAEAELGASLGRNVVKLPDWAALRAAAAGTAAH GT:EXON 1|1-448:0| BL:SWS:NREP 1 BL:SWS:REP 3->432|FPRA_MYCTU|2e-74|42.9|422/456| SEG 144->156|avvigvgnvavdv| SEG 259->270|prrirprfflrp| SEG 436->447|aalraaaagtaa| BL:PDB:NREP 1 BL:PDB:REP 3->432|1lqtB|2e-75|43.1|422/454| RP:PDB:NREP 1 RP:PDB:REP 3->432|1e6eC|1e-11|33.9|425/456| HM:PFM:NREP 1 HM:PFM:REP 4->207|PF07992|4.7e-12|25.4|142/202|Pyr_redox_2| RP:SCP:NREP 3 RP:SCP:REP 1->126|2hy5B1|2e-15|14.2|120/132|c.114.1.1| RP:SCP:REP 103->138|1cjcA1|3e-04|44.4|36/225|c.3.1.1| RP:SCP:REP 271->315|1gt8A3|2e-04|28.9|45/153|c.3.1.1| HM:SCP:REP 2->316|1lqtA2|3.8e-51|40.5|232/0|c.4.1.1|1/2|Nucleotide-binding domain| OP:NHOMO 575 OP:NHOMOORG 375 OP:PATTERN ----------------------------------------------------------1-1------- 1---111222211144333-3333433333343343577612122211122243312311--2111333422222222----11-111----------------1--11----------------11---------11111---1-1-1---1------------------------------111-------1-----------------1111---1---1-1-------------------------------------------------------------------------------------------------------------------11----------111--11-11-----------------------111--1-1--11111111111111-11-11-1-11--111211-111---------------------------------------------------------------2111------1----1-------1---------1------------------------1--------------------------------1-11-----111------------------------------------1------11111---1111-1--1-2---1-11-----------1---------------------------------11-------------------------------------------------------1--11---------------------------------------1----------------------------------------------------------------------------------------2-1---1-1--1- 1111112-311-1111112222112222212221111111111112111111111221111111111111111221111112221222--1111111111111112-11121121-21-1-111111215K2-115-11111111-11--1--11111111111121123222211111D2111112111112222222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 432 STR:RPRED 96.4 SQ:SECSTR TcEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccccTHHHHTccTTcGGGGGHHHHHHHHHTcTTEEEEccccccTTTccHHHHHHHccEEEEccccccccccccTTTTcTTEEEHHHHHHHHTTcGGGTTccccccccEEEEEcccHHHHHHHHHHHccGGGGTTccccHHHHHHHHHccccEEEEEccccGGGccccHHHHHHHHTcTTEEEEccGGGGTTcHHHHHTccHHHHHHHHHccccHHHHHHHHTccEEEEEEccEEEEEEEEcTTEEEEEEEEEEccGGGcEEEEEEEEEEEEccEEEEcccccccccTTccccTTTTcccEETTEETTcT##cTTEEEcTHHHHcTTccHHHHHHHHHHHHHHHHTTccccccccTHHHHHHHHHTTTcccccHHHHHHHHHHHHHHHHTTTcccccccc############## DISOP:02AL 251-258, 418-429, 445-448| PSIPRED ccEEEEEcccHHHHHHHHHHHHHcccccEEEEEcccccccEEEEccccccccHHHHHHHHHHHHHHcccEEEEcEEEccEEccHHHHHHcccEEEEEEcccccccccccccccccEEHHHHHHHHHHccccHHcccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHccccccEEHHHcccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHccHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEcccccEEEEEEEEEEEcccccccccccEEEEEccEEEEEEcccccccccccccccccEEcccccEEEEcccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccc //