[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fprC
DDBJ      :fprC         putative ferredoxin reductase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  321/915 : Eukaryota  136/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:405 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->358 2yvjA PDBj 4e-45 38.7 %
:RPS:PDB   2->362 1d7yA PDBj 1e-33 33.4 %
:RPS:SCOP  2->132 1fcdA1  c.3.1.5 * 3e-09 22.8 %
:RPS:SCOP  114->229 1d7yA2  c.3.1.5 * 2e-11 25.9 %
:RPS:SCOP  221->305 1f8wA1  c.3.1.5 * 3e-10 20.0 %
:RPS:SCOP  305->365 1d7yA3  d.87.1.1 * 7e-15 27.9 %
:HMM:SCOP  1->187 1gv4A1 c.3.1.5 * 3.5e-43 43.0 %
:HMM:SCOP  136->300 1d7yA1 c.3.1.5 * 3.8e-32 38.8 %
:HMM:SCOP  303->381 1q1rA3 d.87.1.1 * 2.9e-20 42.9 %
:RPS:PFM   4->134 PF07992 * Pyr_redox_2 5e-07 33.1 %
:HMM:PFM   3->270 PF07992 * Pyr_redox_2 1e-36 36.1 191/202  
:BLT:SWISS 4->364 THCD_RHOER 7e-43 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69320.1 GT:GENE fprC GT:PRODUCT putative ferredoxin reductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1975840..1977057) GB:FROM 1975840 GB:TO 1977057 GB:DIRECTION - GB:GENE fprC GB:PRODUCT putative ferredoxin reductase GB:NOTE PF00070: Pyridine nucleotide-disulphide oxidoreductase GB:PROTEIN_ID BAC69320.1 LENGTH 405 SQ:AASEQ MKRILVVGASAAGLTAAETLRREGYDGTITLVGDECHAPYDRPPLSKQLLAAEWEPERLALRTPGDLEALDLDLRLGVAATGLDVTDRTVRLADGSSVPYDGLIVATGVRPRRLPGEGAHVLRTVDDALALRDRLGPGTRLVVVGAGFLGAEAAAVARRLGADVTLLEPAPVPLAHAVGAEVGEVLSRAHLEHGVELRTGVTVTEVTDEGVRLADGEVVEADEILVAIGCLPNTEWLKGSGLTLGDGLVCDAYGEAARSVYGAGDVARWHNPLFGVSMRIEHRTNAAEHGMAAARNLLRPEARRPFAPVPYFWSDQYDMKIQAYGYFRAHDETVVVEGDLAERRFVAAYRTGDRLTGALAAGLPPRAIRRWRQAIAAGATWREAVRDNISPATAPWGSVLPEKIT GT:EXON 1|1-405:0| BL:SWS:NREP 1 BL:SWS:REP 4->364|THCD_RHOER|7e-43|33.8|358/427| SEG 140->162|rlvvvgagflgaeaaavarrlga| SEG 199->211|tgvtvtevtdegv| SEG 366->379|rairrwrqaiaaga| BL:PDB:NREP 1 BL:PDB:REP 4->358|2yvjA|4e-45|38.7|349/402| RP:PDB:NREP 1 RP:PDB:REP 2->362|1d7yA|1e-33|33.4|356/401| RP:PFM:NREP 1 RP:PFM:REP 4->134|PF07992|5e-07|33.1|130/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 3->270|PF07992|1e-36|36.1|191/202|Pyr_redox_2| RP:SCP:NREP 4 RP:SCP:REP 2->132|1fcdA1|3e-09|22.8|127/186|c.3.1.5| RP:SCP:REP 114->229|1d7yA2|2e-11|25.9|116/121|c.3.1.5| RP:SCP:REP 221->305|1f8wA1|3e-10|20.0|85/198|c.3.1.5| RP:SCP:REP 305->365|1d7yA3|7e-15|27.9|61/97|d.87.1.1| HM:SCP:REP 1->187|1gv4A1|3.5e-43|43.0|186/0|c.3.1.5|1/2|FAD/NAD(P)-binding domain| HM:SCP:REP 136->300|1d7yA1|3.8e-32|38.8|165/184|c.3.1.5|2/2|FAD/NAD(P)-binding domain| HM:SCP:REP 303->381|1q1rA3|2.9e-20|42.9|77/103|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 932 OP:NHOMOORG 487 OP:PATTERN ------1111122211-------1111111-11-1--111111------1-1-1------1------- --2141-1222---52222-25--34222221756557GH3221212--1--425-2---1-713396433-----------1-----------------------1-------------------------------------11-------------------------------------1--111------------------1-11111-----------------------------------11----1-11-----11---------------------------------------------------------1-1-------------1--------11----1-2211---1222211------4112-----432112211121111111-11111-22322444-41-322233622355-23211121111211---------111-2--------------------------------1231-4432134445424444554544441452A-43-1-11-32-11122351112-1-----------22133-111--1----1-----1--12131111111-1-------------------------1111-121--1-----------------1--1----1-1------1----1-2221211122-222221112221212222121111111----------------11111122---------------------------12-2----------------33323-3-1-2-11111-1121131--1----------------------1------1-----------1-----------------------------------------------------11- 11--111-1---22121-21111111111111111111111111111111222211121111------------------------11-12111111111111-11-2-1445333-11-11113312-7A2-213-11--1121-1-1-----12222133-2111922321111----1-1-21112152------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 90.1 SQ:SECSTR cccEEEEcccHHHHHHHHHHHHHTccccEEEEEcccccccccGGGGTTHHHHccGGGccccGGGcTTcHTTcEEEETccEEEEETTTTEEEETTccEEEccEEEEcccEEEccTccccEEEcccHHHHHHHHHHccTTcEEEEEcccHHHHHHHHHHHHTTcEEEEEEccccTTTTTccHHHHHHHHHHHHTTTcEEEEcccEEEEETTEEEETTccEEEccEEEEcccEEEccHHHHHTTccccccEEccTTccccTTEEEcGGGEEEEcTTTccEEEcccHHHHHHHHHHHHHHHHcTTTccccccccEEEEEETTEEEEEEEcccccEEEEEEEccccccEEEEEEEETTEEEEEEEEcccH######################################## PSIPRED ccEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHcccccHHHHHcccHHHHHHcccEEEEccEEEEEEccccEEEEccccEEEccEEEEccccEEEEccccccEEEccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEccEEEEccccEEEccEEEEEccEEEcHHHHHHcccccccEEEEcccccccccEEEccEEEEcccccccccEEcccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEcccccccEEEEEccccccEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHccccccccHHHHcccccc //