[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fsr
DDBJ      :fsr          putative fosmidomycin resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:411 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->383 1pw4A_ f.38.1.1 * 1.1e-43 26.5 %
:HMM:PFM   12->341 PF07690 * MFS_1 1.5e-23 25.1 327/353  
:BLT:SWISS 10->139 FSR_ECOLI 1e-14 49.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68362.1 GT:GENE fsr GT:PRODUCT putative fosmidomycin resistance protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(809624..810859) GB:FROM 809624 GB:TO 810859 GB:DIRECTION - GB:GENE fsr GB:PRODUCT putative fosmidomycin resistance protein GB:NOTE probable membrane efflux protein, PF07690: Major Facilitator Superfamily putative fosmidomycin resistance protein (membrane efflux protein) GB:PROTEIN_ID BAC68362.1 LENGTH 411 SQ:AASEQ MRRKTSITLLSVGHACVDIYQGAVASLVPFFVAERAYSYAAVSGIVLAASLLSSVVQPVFGVLTDRWTMPWLLPVSTLLGGLGIALSGVGGPYALTLVFVAVSGVGVAAYHPESARVARIAGRGSHGGMGWFSVGGNLGFAAAPLMVAAVVATGGLRLTPLLVLPALVGAVLCLPVLRALEQQQSAGAGAAVWAGVDDRASFVKLSLAVVCRSIVFVGLSTFISLYAKERMGGSTAAGTAALFVLYLGGAVGSVLGGALADRWDRITVARWSYLLTAGSVAGVVFVPGPALYLCVALTSAGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTVSIGGLASPLIGSLADATSLQAALSPLILMPALSWLLFRTLPEPVVPQPEPIVPQPGATAHPKGDDTDATLSHARPDHD GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 10->139|FSR_ECOLI|1e-14|49.2|130/406| TM:NTM 10 TM:REGION 9->31| TM:REGION 41->63| TM:REGION 79->101| TM:REGION 133->155| TM:REGION 159->181| TM:REGION 203->225| TM:REGION 236->258| TM:REGION 282->304| TM:REGION 324->346| TM:REGION 352->374| SEG 78->91|llgglgialsgvgg| SEG 98->109|vfvavsgvgvaa| SEG 141->177|aaaplmvaavvatgglrltpllvlpalvgavlclpvl| SEG 186->196|agagaavwagv| SEG 244->260|vlylggavgsvlggala| SEG 374->388|pepvvpqpepivpqp| HM:PFM:NREP 1 HM:PFM:REP 12->341|PF07690|1.5e-23|25.1|327/353|MFS_1| HM:SCP:REP 1->383|1pw4A_|1.1e-43|26.5|381/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 206 OP:NHOMOORG 200 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------------------1-------------1--------------1111------------1-------------------------------------------------------------------------------------------------------------1-111111111111111------1111------------2-------------------------------------------------------------------------------------------------------1-1--11---------1------1-1---11-------------------1-1--11-1111111111111111-------------111-11111111-------2---------------1----------------------------------------------11111111111111-111111111-1-11--111--1--------------------------------------1---------------------11111----------------------111-1----------------------------------------1----111111111111-11111111-1111111111111-111-11111111111111111-1-1111--11111111-111-----------------------1---------11111-1---------1-11-22211--1------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 180-199, 387-396, 400-411| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccc //