[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gldA
DDBJ      :gldA         putative glycerol 1-phosphate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  230/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
e.22.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->112 1oj7A PDBj 4e-05 34.2 %
:BLT:PDB   88->342 3ce9B PDBj 1e-32 36.6 %
:RPS:PDB   10->344 3ce9B PDBj 3e-32 28.2 %
:RPS:SCOP  6->329 1jpuA  e.22.1.2 * 3e-38 22.7 %
:HMM:SCOP  1->346 1dqsA_ e.22.1.1 * 7.7e-59 25.9 %
:RPS:PFM   88->305 PF01761 * DHQ_synthase 3e-10 33.7 %
:HMM:PFM   16->320 PF01761 * DHQ_synthase 5.9e-52 25.2 286/313  
:BLT:SWISS 20->331 G1PDH_METHJ 4e-50 38.8 %
:PROS 245->254|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69370.1 GT:GENE gldA GT:PRODUCT putative glycerol 1-phosphate dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2030644..2031705) GB:FROM 2030644 GB:TO 2031705 GB:DIRECTION - GB:GENE gldA GB:PRODUCT putative glycerol 1-phosphate dehydrogenase GB:NOTE PF01761: 3-dehydroquinate synthase GB:PROTEIN_ID BAC69370.1 LENGTH 353 SQ:AASEQ MPVLTRLIPSPVVVDIRPGALDDLASVLADQRISHSGKLAVAISGGSGAKLRERLAPALPGATWYEVGGGTLDDAIKLADDMKSGHYDAVVGLGGGKIIDCAKFAAARIGLPLVAVATNLSHDGLCSPVATLDNDAGRGSYGVPNPIAVVIDLDVIREAPVRFVRSGIGDALSNISAVRDWELAHREKGEQIDGLAAAMARQAGEAVLRHPGGVGDDSFLQVLAEGLVLTGISMSVAGDSRPASGACHEINHAFDLLFPKRAASHGEQCGMGAAFAMHLRGAHEESGYMAEVLHRHGLPVLPDEIGFTVDEFVQVVEFAPQTRPGRYTILEHLDLNTEQIRDAYADYAKAIGS GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 20->331|G1PDH_METHJ|4e-50|38.8|304/359| PROS 245->254|PS00142|ZINC_PROTEASE|PDOC00129| BL:PDB:NREP 2 BL:PDB:REP 31->112|1oj7A|4e-05|34.2|79/390| BL:PDB:REP 88->342|3ce9B|1e-32|36.6|246/342| RP:PDB:NREP 1 RP:PDB:REP 10->344|3ce9B|3e-32|28.2|323/342| RP:PFM:NREP 1 RP:PFM:REP 88->305|PF01761|3e-10|33.7|199/312|DHQ_synthase| HM:PFM:NREP 1 HM:PFM:REP 16->320|PF01761|5.9e-52|25.2|286/313|DHQ_synthase| GO:PFM:NREP 2 GO:PFM GO:0003856|"GO:3-dehydroquinate synthase activity"|PF01761|IPR002658| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01761|IPR002658| RP:SCP:NREP 1 RP:SCP:REP 6->329|1jpuA|3e-38|22.7|317/361|e.22.1.2| HM:SCP:REP 1->346|1dqsA_|7.7e-59|25.9|340/388|e.22.1.1|1/1|Dehydroquinate synthase-like| OP:NHOMO 389 OP:NHOMOORG 303 OP:PATTERN 11111111111111111111111112211111111111111111211111111111111111111-11 ------------------------------------------------------------11-2---1212-------1----------------------------------------------1-------1-----1--------111111111-11112-111--11-1-----1---------11-111---------------1122-1-----1--11111111-1----------------11----1-11-------1111-1-1-----2221111122111111121111111111111111111---111-1--1322221222211---111--1---1-1---------111---11-1------------------------------------------1----------------11------------1------------------1111-11111---------------1-11------1-----------------------------1---------------------------------------------------11-----1----------1-----------------------------111-------------------------1--------------2-11-1-2222232322-223232222222222222223211111212121222221211212221112--2--------------------------------------------------------------------1------------------------1----------------------------------------------------------------11--21222--- -----1--------------------------------------------------------------------------------11-22---1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 345 STR:RPRED 97.7 SQ:SECSTR #####EETTcccEEEEEcccGGGHHHHHHTTTccccEEEEEEEETTHHHHHHHHHHHHHHTTTEEEEEccccHHHHHHHHTTccTTccEEEEEEcHHHHHHHHHHHHHGTccEEEEEcccccGGGTccEEEEEETTEEEEEEcccccEEEEEHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHcccccTTcHHHHHHHHHHHHHHHHHHHHHTccTTTccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHTTHHHHHHTTccHHHHHHHHHHHHHHHcTTcccGGGccHHHHHHHHHHHHHHHHH### DISOP:02AL 1-3| PSIPRED cccEEEEEEccEEEEEcccHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEccccEEEEEEccccEEEEcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcc //