[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gvpF1
DDBJ      :gvpF1        putative gas vesicle synthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->237 PF06386 * GvpL_GvpF 8e-35 44.2 %
:HMM:PFM   2->238 PF06386 * GvpL_GvpF 7.5e-62 39.6 235/250  
:BLT:SWISS 3->238 GVPL_ANAFL 7e-11 26.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68307.1 GT:GENE gvpF1 GT:PRODUCT putative gas vesicle synthesis protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(749194..749916) GB:FROM 749194 GB:TO 749916 GB:DIRECTION - GB:GENE gvpF1 GB:PRODUCT putative gas vesicle synthesis protein GB:NOTE PF06386: Gas vesicle synthesis protein GvpL/GvpF GB:PROTEIN_ID BAC68307.1 LENGTH 240 SQ:AASEQ MAVYVYAITAASHPLRLDGVTGVGEPPEKLRTVNSRSLAAVVSDAPDGLRAKRRDVLAHEAVLERLMAEGSVLPLRFGAVTSDDQAVLQVLDERAASYQERLTALDGCVEFHLKASCDEDALLREILLQSPEAHQLNEQIRSGRAGPDLQIALGERVAGEVQLRHESFAAGAVEALRPLARDIRASDPKGGDFVSVSFLVDKARQEGFTAAEQDLANERGADFDFRLHGPLPPYSFVEAT GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 3->238|GVPL_ANAFL|7e-11|26.6|229/245| RP:PFM:NREP 1 RP:PFM:REP 3->237|PF06386|8e-35|44.2|231/247|GvpL_GvpF| HM:PFM:NREP 1 HM:PFM:REP 2->238|PF06386|7.5e-62|39.6|235/250|GvpL_GvpF| GO:PFM:NREP 2 GO:PFM GO:0031411|"GO:gas vesicle"|PF06386|IPR009430| GO:PFM GO:0031412|"GO:gas vesicle organization"|PF06386|IPR009430| OP:NHOMO 40 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -2-------------------------------111--53-111----------------------131---------------------------------------------------------------22-------------------11------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------2----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 128-151| PSIPRED ccEEEEEEEcccccccccccccccccccEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccc //