[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gvpG1
DDBJ      :gvpG1        putative gas vesicle synthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->81 PF05120 * GvpG 1.1e-33 54.7 75/80  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68306.1 GT:GENE gvpG1 GT:PRODUCT putative gas vesicle synthesis protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(748925..749176) GB:FROM 748925 GB:TO 749176 GB:DIRECTION - GB:GENE gvpG1 GB:PRODUCT putative gas vesicle synthesis protein GB:NOTE PF05120: Gas vesicle protein G GB:PROTEIN_ID BAC68306.1 LENGTH 83 SQ:AASEQ MGLLTHLLTLPLAPVRGVGWVMQQVAQVAEEQYYDPDPVLKELAELERALVSGQIDQETFDRREDELLDRLEEITRFREGTGA GT:EXON 1|1-83:0| SEG 3->12|llthlltlpl| SEG 23->34|qqvaqvaeeqyy| SEG 61->73|drredelldrlee| HM:PFM:NREP 1 HM:PFM:REP 7->81|PF05120|1.1e-33|54.7|75/80|GvpG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 81-83| PSIPRED cHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccc //