[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gvpK1
DDBJ      :gvpK1        putative gas vesicle synthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   47->131 PF05121 * GvpK 4e-20 61.2 %
:HMM:PFM   46->132 PF05121 * GvpK 3.2e-37 51.7 87/89  
:HMM:PFM   9->47 PF12440 * MAGE_N 1.8e-05 28.2 39/96  
:BLT:SWISS 59->136 GVPK_ANASP 4e-08 38.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68301.1 GT:GENE gvpK1 GT:PRODUCT putative gas vesicle synthesis protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(746752..747162) GB:FROM 746752 GB:TO 747162 GB:DIRECTION - GB:GENE gvpK1 GB:PRODUCT putative gas vesicle synthesis protein GB:NOTE PF05121: Gas vesicle protein K GB:PROTEIN_ID BAC68301.1 LENGTH 136 SQ:AASEQ MTPDTPRHQGRSDEAADAAPGPFRLFPAAPQDVPASGNESPPHPASRINTDPDTVERDLIKLVLTLVELIRQLMERQALHRVDAGDLTEEEEERLGMTLMVLHDRLNDLCGRYGLTMQDLNIDLGPLGTLLPPSDY GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 59->136|GVPK_ANASP|4e-08|38.5|78/155| RP:PFM:NREP 1 RP:PFM:REP 47->131|PF05121|4e-20|61.2|85/87|GvpK| HM:PFM:NREP 2 HM:PFM:REP 46->132|PF05121|3.2e-37|51.7|87/89|GvpK| HM:PFM:REP 9->47|PF12440|1.8e-05|28.2|39/96|MAGE_N| GO:PFM:NREP 1 GO:PFM GO:0031412|"GO:gas vesicle organization"|PF05121|IPR007805| OP:NHOMO 22 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -------------------------1-------111--11--------------------------132---------------------------------------------------------------1-------------------1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-----------------------------------------------------1-11---------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 32-42, 133-136| PSIPRED cccccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHcccccccc //