[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gvpO1
DDBJ      :gvpO1        putative gas vesicle synthesis protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->119 PF05800 * GvpO 3e-14 51.7 %
:HMM:PFM   25->119 PF05800 * GvpO 4.9e-37 47.4 95/101  
:BLT:SWISS 14->118 GVPO_HALME 7e-11 31.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68309.1 GT:GENE gvpO1 GT:PRODUCT putative gas vesicle synthesis protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(750480..750848) GB:FROM 750480 GB:TO 750848 GB:DIRECTION - GB:GENE gvpO1 GB:PRODUCT putative gas vesicle synthesis protein GB:NOTE PF05800: Gas vesicle synthesis protein GvpO GB:PROTEIN_ID BAC68309.1 LENGTH 122 SQ:AASEQ MPADRNGDSARPRKRTHRGTEESRVRSRGESPRPSQRLSASRAMLSAMQQLKELLGKAPESVSAVRPTDDGWEAEVEVLEIERIPETTSVMASYRVTLDADGELMAYERIRRYTRAQVDRRA GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 14->118|GVPO_HALME|7e-11|31.4|105/140| RP:PFM:NREP 1 RP:PFM:REP 31->119|PF05800|3e-14|51.7|89/96|GvpO| HM:PFM:NREP 1 HM:PFM:REP 25->119|PF05800|4.9e-37|47.4|95/101|GvpO| GO:PFM:NREP 1 GO:PFM GO:0031412|"GO:gas vesicle organization"|PF05800|IPR008634| OP:NHOMO 13 OP:NHOMOORG 8 OP:PATTERN -------------------------21---------------------1------------------- --------------------------------------31---1-----------------------31------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-41, 114-122| PSIPRED cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHccc //