[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : gvpS1
DDBJ      :gvpS1        putative gas vesicle synthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->65 PF00741 * Gas_vesicle 3e-06 53.8 %
:HMM:PFM   27->65 PF00741 * Gas_vesicle 1.1e-18 51.3 39/39  
:BLT:SWISS 10->54 GVPJ_ANASP 8e-04 37.8 %
:BLT:SWISS 28->67 GVPJ_BACME 7e-08 42.5 %
:BLT:SWISS 39->85 GVPS_BACME 2e-05 44.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68302.1 GT:GENE gvpS1 GT:PRODUCT putative gas vesicle synthesis protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(747159..747446) GB:FROM 747159 GB:TO 747446 GB:DIRECTION - GB:GENE gvpS1 GB:PRODUCT putative gas vesicle synthesis protein GB:NOTE PF00741: Gas vesicle protein GB:PROTEIN_ID BAC68302.1 LENGTH 95 SQ:AASEQ MMTDPSDFGPAKPRPPDRGSLPDRQVALIDLLDRLLTGGIVITGDVTLSIADIDLVRISLRALIASIGTTTPSPWSRGGPLPVTSPGHPDQLPSP GT:EXON 1|1-95:0| BL:SWS:NREP 3 BL:SWS:REP 10->54|GVPJ_ANASP|8e-04|37.8|45/148| BL:SWS:REP 28->67|GVPJ_BACME|7e-08|42.5|40/100| BL:SWS:REP 39->85|GVPS_BACME|2e-05|44.4|45/95| RP:PFM:NREP 1 RP:PFM:REP 27->65|PF00741|3e-06|53.8|39/39|Gas_vesicle| HM:PFM:NREP 1 HM:PFM:REP 27->65|PF00741|1.1e-18|51.3|39/39|Gas_vesicle| GO:PFM:NREP 2 GO:PFM GO:0005198|"GO:structural molecule activity"|PF00741|IPR000638| GO:PFM GO:0012506|"GO:vesicle membrane"|PF00741|IPR000638| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------111------------------------------131----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 7-26, 88-95| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEEEEEEEccEEEEEEEEEEEEcccccccccccccccccccccccccccccc //