[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : hsp18_1
DDBJ      :hsp18_1      putative heat shock protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  227/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->121 3glaB PDBj 3e-07 25.8 %
:RPS:PDB   31->127 2byuA PDBj 8e-17 30.9 %
:RPS:SCOP  1->135 1gmeA  b.15.1.1 * 1e-21 30.4 %
:HMM:SCOP  1->133 1gmeA_ b.15.1.1 * 2.8e-32 30.1 %
:RPS:PFM   34->133 PF00011 * HSP20 2e-11 42.4 %
:HMM:PFM   37->133 PF00011 * HSP20 6.1e-23 32.6 95/102  
:BLT:SWISS 1->144 HSP18_STRAL 1e-54 68.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68169.1 GT:GENE hsp18_1 GT:PRODUCT putative heat shock protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 612565..612999 GB:FROM 612565 GB:TO 612999 GB:DIRECTION + GB:GENE hsp18_1 GB:PRODUCT putative heat shock protein GB:NOTE PF00011: Hsp20/alpha crystallin family GB:PROTEIN_ID BAC68169.1 LENGTH 144 SQ:AASEQ MLMRTDPFRELDRLTQQLLNTTGTWSRPSAMPMDAYREGEEYVIAFDLPGVSADAIDIDVERNMLTVKAERRPVTKADDAQMELSERPLGAFSRQLVLADTLDTEHIKADYDAGVLTLRIPIAERAKPRKIAIGGRTERKEISG GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|HSP18_STRAL|1e-54|68.5|143/143| BL:PDB:NREP 1 BL:PDB:REP 33->121|3glaB|3e-07|25.8|89/99| RP:PDB:NREP 1 RP:PDB:REP 31->127|2byuA|8e-17|30.9|97/101| RP:PFM:NREP 1 RP:PFM:REP 34->133|PF00011|2e-11|42.4|99/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 37->133|PF00011|6.1e-23|32.6|95/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 1->135|1gmeA|1e-21|30.4|135/150|b.15.1.1| HM:SCP:REP 1->133|1gmeA_|2.8e-32|30.1|133/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 352 OP:NHOMOORG 241 OP:PATTERN ---------------------------1---------------------1------------------ 1-111---------243----21111-----111111133212-2----11212111----1111132--1-----------1111----------------------3-----------------111111111-111221-11-222211111----11---1--122-------------11122------------------------------111-----------------------------------------------------------------------------------------------------------------------11-----11--1---1----11------1-----222--1-------2-1------------------1---1-1-1-11--------2----1-------------------------------------------------2-1-------1-1--6------322124212221111222221113211---21-11-1-----1-1-11--11--------1122-123-3-12-1-1222-212424133122221141-------------------1111-------1------------------1----1----1-11--------------------------------------------------------------------------------------------111111---12-2---------------------------1----------1---1----11111-111------------------------1111--3-11----------------------------------------1-11------11- ----1---------1-----------------------------------------------------------------------1--431-54------------1-------------------------------------------------------------------1-------1------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 98.6 SQ:SECSTR EEEETTTEEEEccccccccccccccccEEEccEEEEEcccEEEEEEEcTTccGGGEEEEEETTTEEEEEccccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEccccccccccccccccTTEEE## DISOP:02AL 72-80, 123-144| PSIPRED cccccccHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEEEccccHHEEEEEEEccEEEEEEEEcccccccccEEEEEEEEEEEEEEEEEccccccccEEEEEEEccEEEEEEEcccccccEEEEEccccccEEccc //