[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : idi
DDBJ      :idi          putative isopentenyl-diphosphate delta-isomerase
Swiss-Prot:IDI_STRAW    RecName: Full=Isopentenyl-diphosphate Delta-isomerase;         Short=IPP isomerase;         EC=5.3.3.2;AltName: Full=Isopentenyl pyrophosphate isomerase;AltName: Full=IPP:DMAPP isomerase;

Homologs  Archaea  4/68 : Bacteria  146/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->177 1nfsB PDBj 6e-17 36.4 %
:RPS:PDB   21->181 2dhoA PDBj 2e-16 31.1 %
:RPS:SCOP  21->180 2o5fA1  d.113.1.2 * 4e-25 17.6 %
:HMM:SCOP  20->184 1hx3A_ d.113.1.2 * 3.4e-42 37.8 %
:RPS:PFM   75->165 PF00293 * NUDIX 8e-04 34.1 %
:HMM:PFM   48->175 PF00293 * NUDIX 1.3e-25 26.6 124/135  
:BLT:SWISS 1->197 IDI_STRAW e-107 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69374.1 GT:GENE idi GT:PRODUCT putative isopentenyl-diphosphate delta-isomerase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2035914..2036507 GB:FROM 2035914 GB:TO 2036507 GB:DIRECTION + GB:GENE idi GB:PRODUCT putative isopentenyl-diphosphate delta-isomerase GB:NOTE EC 5.3.3.2, PF00293: NUDIX domain GB:PROTEIN_ID BAC69374.1 LENGTH 197 SQ:AASEQ MPITPATSTHSSSNGTAEAILLELVDENGTTIGTAEKLAAHQPPGQLHRAFSVFLFDEQGRLLLQQRALGKYHSPGVWSNTCCGHPYPGEAPFAAAARRTHEELGVSPSLLAEAGTVRYNHPDPDSGLVEQEFNHLFVGLVQSPLRPDAEEIGDTAFVTAAELAERHAKDPFSSWFMTVLDAARPAVRELTGPSAGW GT:EXON 1|1-197:0| SW:ID IDI_STRAW SW:DE RecName: Full=Isopentenyl-diphosphate Delta-isomerase; Short=IPP isomerase; EC=5.3.3.2;AltName: Full=Isopentenyl pyrophosphate isomerase;AltName: Full=IPP:DMAPP isomerase; SW:GN Name=idi; OrderedLocusNames=SAV_1663; SW:KW Complete proteome; Cytoplasm; Isomerase; Isoprene biosynthesis;Magnesium; Manganese; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->197|IDI_STRAW|e-107|100.0|197/197| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| SEG 59->70|qgrlllqqralg| BL:PDB:NREP 1 BL:PDB:REP 24->177|1nfsB|6e-17|36.4|151/180| RP:PDB:NREP 1 RP:PDB:REP 21->181|2dhoA|2e-16|31.1|161/215| RP:PFM:NREP 1 RP:PFM:REP 75->165|PF00293|8e-04|34.1|85/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 48->175|PF00293|1.3e-25|26.6|124/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 21->180|2o5fA1|4e-25|17.6|148/155|d.113.1.2| HM:SCP:REP 20->184|1hx3A_|3.4e-42|37.8|164/0|d.113.1.2|1/1|Nudix| OP:NHOMO 309 OP:NHOMOORG 267 OP:PATTERN ---------------------------1--1-----------------------------------11 ----1111111------11-11--1-11111-1---1-1--111111111111--11---21-1111111-----------1-----------------11111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1----------------------------------------------------------------1--------------------11-1111111--------------1----------------------------------------------------11--------------------------------------------------2------------------------------------------------------------------------------------------------1-------1---1111111111111-111111111211111111111111221111111111111111111111111------------------11111----------------------------------1-----------------------------111----------------------------------------------------------------------------------- ------1-------111111111111111111111111111111111-1111111-1-111111-1111-11-1------------1--1-21-111-11111112--1-21-------1-11-1--1-171-121-------1----1----2--11---111-1-2-------1111K11-1112411211111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 89.8 SQ:SECSTR ####################EEEEEcTTccEEEEEEHHHHTcHTTccEEEEEEEEEcTTccEEEEEEcTTccccTTcEEccEEEcccGGHHHHHHHHHHHHHHHcccGGGccGGGcEEEEEEEEEcccccEEEEEEEEEEEcccccccTTTEEEEEEEcHHHHHHHTTcccccHHHHHHHHHHTTcccTTTcTcccc DISOP:02AL 1-16, 195-197| PSIPRED cccccccccccccccccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEEEEEcccEEEEEEEccccccccccEEccccccccccccHHHHHHHHHHHHHcccHHHEEEEEEEEEEEEcccccEEEEEEEEEEEEEEcccccccHHHHHHEEEccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccc //