[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : infA2
DDBJ      :infA2        putative translation initiation factor IF-1
Swiss-Prot:IF12_STRAW   RecName: Full=Translation initiation factor IF-1 2;

Homologs  Archaea  0/68 : Bacteria  895/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->73 1ah9A PDBj 8e-22 66.7 %
:RPS:PDB   5->73 1ah9A PDBj 1e-16 63.8 %
:RPS:SCOP  5->74 1jt8A  b.40.4.5 * 1e-16 23.2 %
:HMM:SCOP  2->72 1hr0W_ b.40.4.5 * 1.3e-26 59.2 %
:RPS:PFM   8->71 PF01176 * eIF-1a 6e-21 71.9 %
:HMM:PFM   8->71 PF01176 * eIF-1a 5.2e-27 52.4 63/65  
:BLT:SWISS 1->74 IF12_STRAW 6e-39 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68214.1 GT:GENE infA2 GT:PRODUCT putative translation initiation factor IF-1 GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(646906..647130) GB:FROM 646906 GB:TO 647130 GB:DIRECTION - GB:GENE infA2 GB:PRODUCT putative translation initiation factor IF-1 GB:NOTE PF00575: S1 RNA binding domain GB:PROTEIN_ID BAC68214.1 LENGTH 74 SQ:AASEQ MTKNKNVIEVEGKVVECLRSAMFTVELENGHQVLAHISGKIRKNYIKIMLEDRVLVELPPYDLTRGRIVFRYRN GT:EXON 1|1-74:0| SW:ID IF12_STRAW SW:DE RecName: Full=Translation initiation factor IF-1 2; SW:GN Name=infA2; OrderedLocusNames=SAV_504; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->74|IF12_STRAW|6e-39|100.0|74/74| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 8->73|1ah9A|8e-22|66.7|66/71| RP:PDB:NREP 1 RP:PDB:REP 5->73|1ah9A|1e-16|63.8|69/71| RP:PFM:NREP 1 RP:PFM:REP 8->71|PF01176|6e-21|71.9|64/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 8->71|PF01176|5.2e-27|52.4|63/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 5->74|1jt8A|1e-16|23.2|69/102|b.40.4.5| HM:SCP:REP 2->72|1hr0W_|1.3e-26|59.2|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 985 OP:NHOMOORG 906 OP:PATTERN -------------------------------------------------------------------- 1121211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111222122222222232321112222222221222333312222212332121111112222221-11111111222-1111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111211111111111111-111-111111----1-1--11111111111-11121 1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1---2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 97.3 SQ:SECSTR ##cccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEcccccH DISOP:02AL 1-3, 73-74| PSIPRED ccccccEEEEEEEEEEcccccEEEEEEccccEEEEEEccEEEEEEEEEEEccEEEEEEccccccccEEEEEEcc //