[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : insA
DDBJ      :insA         putative IS701 family ISFsp9-like transposase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:430 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   205->265 1j3lF PDBj 2e-04 40.7 %
:RPS:SCOP  314->411 1mm8A  c.55.3.4 * 1e-07 21.3 %
:HMM:SCOP  33->408 1musA_ c.55.3.4 * 9.1e-13 18.2 %
:HMM:PFM   195->343 PF01609 * Transposase_11 4e-05 20.7 116/207  
:HMM:PFM   362->412 PF05059 * Orbi_VP4 0.00065 41.2 51/644  
:BLT:SWISS 27->233 T701_FREDI 5e-21 34.5 %
:BLT:SWISS 205->265 RRAA_THET8 7e-04 40.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68380.1 GT:GENE insA GT:PRODUCT putative IS701 family ISFsp9-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(828242..829534) GB:FROM 828242 GB:TO 829534 GB:DIRECTION - GB:GENE insA GB:PRODUCT putative IS701 family ISFsp9-like transposase GB:NOTE PF01609: Transposase DDE domain, IS701 family (830160..828223). Inverted repeat sequence (22/24 bp) GB:PROTEIN_ID BAC68380.1 LENGTH 430 SQ:AASEQ MAAGHSVDPACWREAFEGLMSRIAGRFTRVESRRRARKLVLGLLSDLPRKNCWTIAEWAGDRTPDDMQHLLERAKWDADQVRDEVGDYVVEHLHDDEAVLVVDETGDVKKGTDTVGVQRQYTGTAGRIENAQVAVYLVYAGRRGHAAVDRELYVPRSWTSDPDRCRAAGLGDNTEFATKPELAARTVTRFLDAGHRAAWVAGDEVYGDNPRLRTALEERGTGYVLAVACSHEVTTGAGRFRADMLARKVPKSAWQKLSAGAGAEGHRFYDWAAIDLTDPRPGSRQLLIRRNRSTGERAYYRCYSPAAVPLTTLVRVAGSRWRVEELFQSGKGLAALDEHQVRRYPSWSRWVTLAMLAHAFLAVLRANEHEGHPSPDELKPLTCDEIQRLFITLVNRTVFDPVHRLRWSVWRRRHQARSQTSHYRRQAAQA GT:EXON 1|1-430:0| BL:SWS:NREP 2 BL:SWS:REP 27->233|T701_FREDI|5e-21|34.5|194/380| BL:SWS:REP 205->265|RRAA_THET8|7e-04|40.7|54/100| BL:PDB:NREP 1 BL:PDB:REP 205->265|1j3lF|2e-04|40.7|54/156| HM:PFM:NREP 2 HM:PFM:REP 195->343|PF01609|4e-05|20.7|116/207|Transposase_11| HM:PFM:REP 362->412|PF05059|0.00065|41.2|51/644|Orbi_VP4| RP:SCP:NREP 1 RP:SCP:REP 314->411|1mm8A|1e-07|21.3|94/455|c.55.3.4| HM:SCP:REP 33->408|1musA_|9.1e-13|18.2|336/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 565 OP:NHOMOORG 64 OP:PATTERN ------------------------------1--------------------2---------------- --1------------------------11-1-------92--2G----------------13----2711----------------------------------------------------------------------------N---23U-----------5-1--8-------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A-----------4-13-------------------122---2--3--------1-----11-------------MLKLKKKK235-11--------------------------------------------------------2--------1--------7---1--51----------------------3-----------------------6------62------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------------------------------------------------vv*--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 12.6 SQ:SECSTR ############################################################################################################################################################################################################cccccHHHHHHHTTccccccEEE#######EcTTccccccccHHHHHHHHHTccccEEEEE##################################################################################################################################################################### DISOP:02AL 1-4, 363-381, 416-430| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccEEcccccEEEEccccccccccccccEEEEEEEEEEccEEEEEEEEEEEcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccEEEEEccccEEEEccccccHHHHHcccccccccEEEEccccccEEEEEEEEEEEEccccccEEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //