[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : kdpA
DDBJ      :kdpA         putative high-affinity potassium transport system
Swiss-Prot:ATKA_STRAW   RecName: Full=Potassium-transporting ATPase A chain;         EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase A chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] A chain;AltName: Full=Potassium-binding and translocating subunit A;

Homologs  Archaea  8/68 : Bacteria  384/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:554 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->540 PF03814 * KdpA e-133 52.1 %
:HMM:PFM   9->553 PF03814 * KdpA 6.9e-229 53.6 543/555  
:BLT:SWISS 22->540 ATKA_STRAW 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68629.1 GT:GENE kdpA GT:PRODUCT putative high-affinity potassium transport system GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1099967..1101631) GB:FROM 1099967 GB:TO 1101631 GB:DIRECTION - GB:GENE kdpA GB:PRODUCT putative high-affinity potassium transport system GB:NOTE PF03814: Potassium-transporting ATPase A subunit GB:PROTEIN_ID BAC68629.1 LENGTH 554 SQ:AASEQ MSPVLAGVLQLVALIAALALAYRPLGDYMAKVYSSDKHLRVEKWIYKGIGADPDTQMRWPAYLRGVLAFSAVSVLFLYVLQRVQGSLPGSLGFRSIDPDQAFNTAASFVTNTNWQSYYGEQAMGHVVQTGGLAVQNFVSASVGIAVAVALVRGFSRSRTGELGNFWSDLVRGTVRVLLPVSVIAAIVLVACGAIQNFSGIHSVGQFMGGSQQWNGGAVASQEAIKEAGTNGGGYFNANSAHPFENPGPFSNLFEIFLILLIPFALTRTFGRMVGSLRQGYAILATMVTIWIGFTALMMWTEFAHHGPAFQIAGGAMEGKETRFGVGGSSIFAVATTLTSTGAVDSFHSSFTGLGGGITLLSMQLGEIAPGGTGSGLYGILIMAVIAVFIAGLMVGRTPEYLGKKIGTREIKFAACYILITPALALVFTAAAMALPTPGHSMTNSGAHGFSEILYAYTSGANNNGSAFAGLNADTQWFNTTIGIVMLLGRFVPMVFVLALAGSLAEQKPIPATVGTLRTEKPLFTGLLVGAILIITGLTYFPALALGPLAEGLAS GT:EXON 1|1-554:0| SW:ID ATKA_STRAW SW:DE RecName: Full=Potassium-transporting ATPase A chain; EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase A chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] A chain;AltName: Full=Potassium-binding and translocating subunit A; SW:GN Name=kdpA; OrderedLocusNames=SAV_919; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase;Ion transport; Membrane; Nucleotide-binding; Potassium;Potassium transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->540|ATKA_STRAW|0.0|100.0|519/554| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006813|"GO:potassium ion transport"|Potassium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 2->24| TM:REGION 64->86| TM:REGION 131->153| TM:REGION 172->194| TM:REGION 247->269| TM:REGION 281->303| TM:REGION 326->348| TM:REGION 375->397| TM:REGION 411->433| TM:REGION 480->502| TM:REGION 526->548| SEG 4->21|vlagvlqlvaliaalala| SEG 138->151|vsasvgiavavalv| SEG 252->265|lfeiflillipfal| SEG 422->434|alalvftaaamal| SEG 541->553|palalgplaegla| RP:PFM:NREP 1 RP:PFM:REP 23->540|PF03814|e-133|52.1|516/555|KdpA| HM:PFM:NREP 1 HM:PFM:REP 9->553|PF03814|6.9e-229|53.6|543/555|KdpA| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03814|IPR004623| GO:PFM GO:0006813|"GO:potassium ion transport"|PF03814|IPR004623| GO:PFM GO:0008556|"GO:potassium-transporting ATPase activity"|PF03814|IPR004623| OP:NHOMO 430 OP:NHOMOORG 393 OP:PATTERN ----------------1--------11----------------21----------------111---- 11111------1--11111-1---1111111-11111111-11111---11--11--3-----11-1111----------1---1---1111-1-----1-11--111-1------------------1---------------1--1--111--11------11-1322--------------11-----1--111111111111111------111-1-1-1121111111-22121111122211--11-1------------------------------------------------------------------------1--------1-1-111--1-----------------------1----2--111------121111-111111----------1-11-11111-11-11111111111111------1111---2222222221--1111--------------------------------1--1111-1111111111111111111122111111-1111-11--11--1-111--1111------------12-------11-111-1--1111---1--11-1-------11----------------33111-------------------1----1--------1------11111111111111111-11111111111111111111111111-1111111111111111111-1111--111111111111-------------1-------------------1112111-----11211211-1111-1111-111111----------------1111111111------------11----------------------------------------------1-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 509-510, 553-554| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccEEEEccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //