[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : kdpC
DDBJ      :kdpC         putative high-affinity potassium transport system
Swiss-Prot:ATKC_STRAW   RecName: Full=Potassium-transporting ATPase C chain;         EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase C chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] C chain;AltName: Full=Potassium-binding and translocating subunit C;

Homologs  Archaea  3/68 : Bacteria  359/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   30->218 PF02669 * KdpC 1e-38 56.0 %
:HMM:PFM   12->217 PF02669 * KdpC 3.2e-51 48.4 184/188  
:BLT:SWISS 1->222 ATKC_STRAW e-111 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68627.1 GT:GENE kdpC GT:PRODUCT putative high-affinity potassium transport system GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1097100..1097768) GB:FROM 1097100 GB:TO 1097768 GB:DIRECTION - GB:GENE kdpC GB:PRODUCT putative high-affinity potassium transport system GB:NOTE PF02669: K+-transporting ATPase, c chain GB:PROTEIN_ID BAC68627.1 LENGTH 222 SQ:AASEQ MNNSVTNTARLLWAGLRSLLVLTVVTGVLYPLAVTGVAQGLFSDQANGSEIKADGKVVGSSLIGQAYNLPLKKGQETPEPDLKWFQGRPANGLGTNSVNTQYSLILSGATNRSGDNADLIKWVKDAKAAVVKDNSTADHKVKPSDVPADAVTSSGSGLDPDISPEYADLQVHRIAEQNHLAVAPVQKLVDEHTDGRTLGFIGEPRVNVLELNIALKELVATS GT:EXON 1|1-222:0| SW:ID ATKC_STRAW SW:DE RecName: Full=Potassium-transporting ATPase C chain; EC=3.6.3.12;AltName: Full=Potassium-translocating ATPase C chain;AltName: Full=ATP phosphohydrolase [potassium-transporting] C chain;AltName: Full=Potassium-binding and translocating subunit C; SW:GN Name=kdpC; OrderedLocusNames=SAV_917; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase;Ion transport; Membrane; Nucleotide-binding; Potassium;Potassium transport; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->222|ATKC_STRAW|e-111|100.0|222/222| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006813|"GO:potassium ion transport"|Potassium transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 17->39| SEG 19->29|llvltvvtgvl| SEG 123->133|vkdakaavvkd| RP:PFM:NREP 1 RP:PFM:REP 30->218|PF02669|1e-38|56.0|166/188|KdpC| HM:PFM:NREP 1 HM:PFM:REP 12->217|PF02669|3.2e-51|48.4|184/188|KdpC| GO:PFM:NREP 3 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02669|IPR003820| GO:PFM GO:0008556|"GO:potassium-transporting ATPase activity"|PF02669|IPR003820| GO:PFM GO:0016020|"GO:membrane"|PF02669|IPR003820| OP:NHOMO 382 OP:NHOMOORG 363 OP:PATTERN -------------------------11----------------1------------------------ 11111------1--11111-1---1111111-11111111-11111---11--11--1-----11-1111----------1---1---1111-1-----1-11--111-1----------------------------------1--1--111----------11-1322--------------11-----1--111111111111111------111-1-1-1121111111-11111----111----11-1------------------------------------------------------------------------1--------1-1-111--1-----------------------1----1--111------111111-111111----------1--1-1-111-1--11111111111111--------11---2222222221--1111--------------------------------1--1111-1111111111111111111112111111-1111-11--11--1-111--1111------------1--------11-1-1-1--1111---1--11--------111----------------22--1------------------------1--------1------11111111111111111-11111111111111111111111-11-11111111111111111--1-1111-111111111111-------------1-------------------1111111-------1--111-1-1--111111111111---------------1111111111------------11----------------------------------------------1-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 104-113| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccc //