[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ldhA
DDBJ      :ldhA         putative lactate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  333/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.162.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->252 1hygA PDBj 8e-18 34.4 %
:RPS:PDB   96->292 2d4aD PDBj 3e-22 24.9 %
:RPS:SCOP  65->141 1s6yA1  c.2.1.5 * 3e-05 26.0 %
:RPS:SCOP  145->290 1b8pA2  d.162.1.1 * 7e-17 18.6 %
:HMM:SCOP  1->142 1y6jA1 c.2.1.5 * 2.4e-23 31.1 %
:HMM:SCOP  142->290 1ojuA2 d.162.1.1 * 1.8e-19 31.7 %
:RPS:PFM   97->142 PF00056 * Ldh_1_N 3e-05 43.5 %
:RPS:PFM   143->224 PF02866 * Ldh_1_C 2e-04 34.2 %
:HMM:PFM   4->138 PF00056 * Ldh_1_N 1.1e-13 28.8 132/142  
:HMM:PFM   144->192 PF02866 * Ldh_1_C 2.9e-08 28.6 49/174  
:BLT:SWISS 63->190 LDH2_LACLA 4e-20 38.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68048.1 GT:GENE ldhA GT:PRODUCT putative lactate dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(394813..395724) GB:FROM 394813 GB:TO 395724 GB:DIRECTION - GB:GENE ldhA GB:PRODUCT putative lactate dehydrogenase GB:NOTE PF00056: lactate/malate dehydrogenase, NAD binding domain GB:PROTEIN_ID BAC68048.1 LENGTH 303 SQ:AASEQ MGSVGVVGAGAVGQTVAATLVASGICPRLLVVSRTVEQARALAADLDDMRQTTGSPVQPEARRVADLIGCHAVVVAVRAAFTNTRAADVRMGGALTNAPVIRALATTLRGYQGTVLVVTNPVDLMTRLFAETSGCPRVYGIGSNLDSARYRLTLAHLLDVPATTVHGHVIGEHGDGAVVCASSTTVNGTPAAVPLAEVRAELRTRPGQISAGVGRTRSGPAGAVLSTLRKALGLVDGTEELTAEHRGDWLGIPLRFTAGQPVACLPALNADEDAQLAATATKLRDAYQALRPSGPTPNSQETT GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 63->190|LDH2_LACLA|4e-20|38.3|128/314| SEG 2->22|gsvgvvgagavgqtvaatlva| SEG 41->48|alaadldd| BL:PDB:NREP 1 BL:PDB:REP 90->252|1hygA|8e-18|34.4|163/313| RP:PDB:NREP 1 RP:PDB:REP 96->292|2d4aD|3e-22|24.9|197/308| RP:PFM:NREP 2 RP:PFM:REP 97->142|PF00056|3e-05|43.5|46/141|Ldh_1_N| RP:PFM:REP 143->224|PF02866|2e-04|34.2|79/169|Ldh_1_C| HM:PFM:NREP 2 HM:PFM:REP 4->138|PF00056|1.1e-13|28.8|132/142|Ldh_1_N| HM:PFM:REP 144->192|PF02866|2.9e-08|28.6|49/174|Ldh_1_C| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00056|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00056|IPR001236| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02866|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02866|IPR001236| RP:SCP:NREP 2 RP:SCP:REP 65->141|1s6yA1|3e-05|26.0|77/169|c.2.1.5| RP:SCP:REP 145->290|1b8pA2|7e-17|18.6|145/171|d.162.1.1| HM:SCP:REP 1->142|1y6jA1|2.4e-23|31.1|135/0|c.2.1.5|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 142->290|1ojuA2|1.8e-19|31.7|142/152|d.162.1.1|1/1|LDH C-terminal domain-like| OP:NHOMO 786 OP:NHOMOORG 461 OP:PATTERN ---1----11111111-------111111-11-111111111122212-----1------11-1---1 -1---12111111--------1----------1----1--1--1-1--1-------1---11-1---1---1111222--1--111--1111-1-----1-1111-112-----------------11--1-1121222--1--111-1---211-----------1112-------------1-11111-212333333333333333211122333111-223333333221222222222222212221222122223222445522222112333222111121111111111111111111111111111122211111--13-------2-2211111112122-11111---11-1--111-1-1-1--111---------11111-1------1---------------------112-----------1--1-----11-------------1-2111----------1111111111111---111111----------------------------------------------------1--------------------1-1-------11---2-1--1-------2----1----------------------11--1---------------------------------1------11---1-------------------------------111---------------------------------------------------------------------------------------------------------111111111---------------------------------------1111111-1-1----1---11-1-111111-1----111--1-111-1- 1122--1-1-----1--11-1-----------------------------1--1-11-2111-----3-----------------------------------121-1---2533324231421532H1DQ6-65B11127127513-4332181322111231-21231911-15---------3232112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 88.4 SQ:SECSTR ########################cccEEEEEcccHHHHHHHHHHHHHHGGGcccccEEEEccGGGGTTccEEEEccccccccccTTccHHHHHHHHHHHHHHHHHHHHHHTcEEEEccccHHHHHHHHHHHHcccGEEEccHHHHHHHHHHHHHHHHTccGGGEEccEEccccTTcEEcGGGcEETTEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHTccEEEEEEEEEEcGEEEEEEEEETTEEEEEcccccHHHHHHHHHHHHHHHHHHTTccG########### DISOP:02AL 292-303| PSIPRED cEEEEEEcccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHccccEEccccHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //