[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : livG1
DDBJ      :livG1        putative branched-chain amino acid ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  900/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:268 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   22->248 1gajA PDBj 2e-32 37.1 %
:RPS:PDB   13->248 2d3wB PDBj 3e-34 22.5 %
:RPS:SCOP  13->250 1ji0A  c.37.1.12 * 1e-32 32.3 %
:HMM:SCOP  13->253 1g6hA_ c.37.1.12 * 3.4e-54 34.0 %
:RPS:PFM   109->159 PF10027 * DUF2269 5e-04 41.2 %
:HMM:PFM   52->178 PF00005 * ABC_tran 1.3e-18 36.3 113/118  
:HMM:PFM   226->248 PF12399 * BCA_ABC_TP_C 1e-10 56.5 23/23  
:HMM:PFM   39->60 PF03193 * DUF258 0.00078 31.8 22/161  
:BLT:SWISS 11->250 BRAF_PSEAE 3e-37 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68903.1 GT:GENE livG1 GT:PRODUCT putative branched-chain amino acid ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1484023..1484829 GB:FROM 1484023 GB:TO 1484829 GB:DIRECTION + GB:GENE livG1 GB:PRODUCT putative branched-chain amino acid ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC68903.1 LENGTH 268 SQ:AASEQ MSELSDRAGLPGLEIRQLRVSFDGFTAVDGVDLDVRPGDLRFLIGPNGAGKTTLVDAVTGLVKADGSVRFGGAELLGRSVHRIARSGIGRTFQTATVFEELTVLQNLDIAAGAGRSVLTMLRRRTGVPESVARALETVGLTELADSPAGTLAHGQKQWLEIGMLLVQDVRLLLLDEPVAGMSHDERQSTGELLERISEERTVVVIEHDMDFMRSFARSVSVLHAGRVLSEGTVADVQADPKVQEVYLGHAPQESTTAEPAAGVAVQEA GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 11->250|BRAF_PSEAE|3e-37|38.8|240/255| SEG 164->175|llvqdvrlllld| BL:PDB:NREP 1 BL:PDB:REP 22->248|1gajA|2e-32|37.1|224/253| RP:PDB:NREP 1 RP:PDB:REP 13->248|2d3wB|3e-34|22.5|236/244| RP:PFM:NREP 1 RP:PFM:REP 109->159|PF10027|5e-04|41.2|51/150|DUF2269| HM:PFM:NREP 3 HM:PFM:REP 52->178|PF00005|1.3e-18|36.3|113/118|ABC_tran| HM:PFM:REP 226->248|PF12399|1e-10|56.5|23/23|BCA_ABC_TP_C| HM:PFM:REP 39->60|PF03193|0.00078|31.8|22/161|DUF258| RP:SCP:NREP 1 RP:SCP:REP 13->250|1ji0A|1e-32|32.3|232/240|c.37.1.12| HM:SCP:REP 13->253|1g6hA_|3.4e-54|34.0|241/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 25431 OP:NHOMOORG 1120 OP:PATTERN JJ85ECA7FDDCDBD7T6JIGHJOkKOWYMZS65967456764IOBNMCBbOK6BMDIOFF486O155 9IVH*NMRYYZLKIHIIDD-DQ66J*EDEEECWabbfx**MmRzbkdWSUIHkgfFJL88aetPvah*y*SJIHHaPOGFeNZ3364779E629454--469588I9DAA132222323322227GD7BBD6GBGDPUTWVCCBYQNJOOGGOLOJKB6A896HKKSWdTI4A56555B6656WOOMHIF3FKUjjjhkggoSlijgihfcSSPVkllJWYbVMSPOPNPO*vACCCGCCBCCCCCBBCBBB8UGICTTAFBDDVVBBRSIFAGMHEJFRNOPMKPNRQLJJLHHKMJLLJIGGHJIJJKJIHTOOLKKQQRKHgScdXYXZZYXIWJOWQQKGGDgMOJIuIOLFihJPNORDIKKEKIBDGECSMIIE7B669NI***QFb*t**quxrvunwnsr*-TX*SL*Vt**J3**************9AGqw*ysx*zm*99999999hLNAEbRl223-1111111122112222212221-11E75895n**m****z**kljliyy**vrssbt***w**n6CllduWgcj*s****NTVEF5BSHCBCBBBAFCCOcYNhuDONgRKTUPPYAPKMEKLIDLLLNNXeIl669A77788783533333334C755CASSeAYGG7D8PDEEFF7EHBBBBBCGDEG92-2AECE------lY*pKlacbaZcbYbab-bbbZcZabdabZZYZbYYb***xtLLIXVVXXZZZZZXWZWXWpVTOZaXXF2gmmnonmjlppp227556666AABADAfWvIGHKBJ8BCCCHDDGCEEDE8E7CEZGbbZaWolvTfeaTUwqs4442434447HJJRMNNNNTRPMLECBAAA98AA544411DE88677934433333I4C64632-1232263867531411222FMKAAJbKRJ8OE ----B85-FA266B5423121222-214311--11111-1-1111222221232-12122121---------------------------21211------111---56188B8F8A6451494KK3D3K*D1D8G6572E54B849423C52d4CB8U39S38652B9AK59D63252X12235853J1C432LCDC6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 258-268| PSIPRED cccccccccccEEEEEcEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHcccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHcccccccccccccccccccccc //