[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : livH1
DDBJ      :livH1        putative branched-chain amino acid ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  238/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:298 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   167->260 PF02653 * BPD_transp_2 2e-06 31.9 %
:HMM:PFM   8->282 PF02653 * BPD_transp_2 7.5e-52 33.8 263/267  
:BLT:SWISS 29->260 LIVH_SALTY 1e-08 33.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68901.1 GT:GENE livH1 GT:PRODUCT putative branched-chain amino acid ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1482024..1482920 GB:FROM 1482024 GB:TO 1482920 GB:DIRECTION + GB:GENE livH1 GB:PRODUCT putative branched-chain amino acid ABC transporter permease protein GB:NOTE PF02653: Branched-chain amino acid transport system / permease component GB:PROTEIN_ID BAC68901.1 LENGTH 298 SQ:AASEQ MTVIFGQTFTGISIGAVLLLIALGLSLTFGQMNVINMAHGEFIMAGAYTTYVLQKSISSAGLSLLVALPVAFLVSGALGALLEWLLIRRLYLRPLDTLLVTWGVSLMLQQLARDIFGAPNVQTRAPELLTGNITVIGGDDPLTFANSRLFILGLAIAAVVALSLTLRLTPLGRRIRAVVQNRDLAEVSGISTGRVDRTAFFIGSGLAGVAGVALTLVGPIGPTMGTNVIIDAFLVIVVGGIGQLKGSVIVAFVLGVLQSVLEYSTTVSVAKVLVLVAIVAFLQWRPQGLYTLRTRSLV GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 29->260|LIVH_SALTY|1e-08|33.0|230/308| TM:NTM 7 TM:REGION 5->27| TM:REGION 61->83| TM:REGION 90->112| TM:REGION 150->172| TM:REGION 203->225| TM:REGION 233->255| TM:REGION 264->285| SEG 11->27|gisigavlllialglsl| SEG 78->93|lgallewllirrlylr| SEG 149->166|lfilglaiaavvalsltl| SEG 203->218|gsglagvagvaltlvg| SEG 267->282|vsvakvlvlvaivafl| RP:PFM:NREP 1 RP:PFM:REP 167->260|PF02653|2e-06|31.9|94/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 8->282|PF02653|7.5e-52|33.8|263/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 401 OP:NHOMOORG 242 OP:PATTERN ----------------------------1-22--------------------------------1--- -------1111----------1---1------11111111---------1--------------1-12---1---1----------------1------------11---------------------------------------2-11--1----1111-12-1--1-111-11111-1-1--2--11-----------1-1------1-----1--21-----------1--------------------------------------------------------------------------------------------1----------------------1--------------------1-11------------118551--4244322222122212-34321224-1--522411122111351--2-211112-222222222----11-------------------------------1-----323-32333522111122111111113462331-1332222---34345-11-1-1------------122-1-------------------1-------1-11----------------------------1122----1-----------------------1--------12-1-11------------------------------11111-------------------1---------111111111111--------------2111---------------------1-1-1211111121111112423----------------------------------------1-------------------------------------------------1----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 298-299| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccHHHcc //