[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : livK1
DDBJ      :livK1        putative branched-chain amino acid ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  307/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:433 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->423 1qo0B PDBj 4e-44 30.3 %
:RPS:PDB   66->391 3cznA PDBj 4e-59 13.4 %
:RPS:SCOP  64->405 1usgA  c.93.1.1 * 3e-52 18.8 %
:HMM:SCOP  65->430 1qo0A_ c.93.1.1 * 2.7e-100 38.3 %
:RPS:PFM   90->370 PF01094 * ANF_receptor 5e-16 31.5 %
:HMM:PFM   87->401 PF01094 * ANF_receptor 2.6e-11 17.4 311/348  
:HMM:PFM   24->45 PF10518 * TAT_signal 0.00053 50.0 22/26  
:BLT:SWISS 68->423 AMIC_PSEAE 2e-44 30.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68900.1 GT:GENE livK1 GT:PRODUCT putative branched-chain amino acid ABC transporter substrate-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1480655..1481956 GB:FROM 1480655 GB:TO 1481956 GB:DIRECTION + GB:GENE livK1 GB:PRODUCT putative branched-chain amino acid ABC transporter substrate-binding protein GB:NOTE PF01094: Receptor family ligand binding region GB:PROTEIN_ID BAC68900.1 LENGTH 433 SQ:AASEQ MSSGPSGSSRSSGSSGSSGSRILRRRFMAGTAALAAVVALSACGAKTDAGGSSDKAAQADVSGDTVKVGLLNSLSGTMAISEVTVRDSLKLAIDEINASGGVLGKKIKPISEDGASDWPTFAEKASKLIKEDRVAATFGCWTSASRKAVKPVFEKNKSLLFYPVQYEGLEESPYIFYTGATTNQQIVPALDYLKSQGKKKIYLVGSDYVFPRTANKIIKAYAKANGMTVLGEDYAPLGSTEFSTIANKVKAAKADAVFNTLNGDSNVAFFKEYKSAGLTAKSMPVVSVSIAEEEVKSIGSQYLAGQLTAWNYYQTTPGAANTKFVKAYKAKYGQGKPTSDPMEAAYTSVYLWKAMVEKAKSFDPEKVKAASDGITFDAPEGKVTVDGASQHIRKTARIGRIGTDGLIEQVWDSGKPIKPDPFLKGYSWASGLS GT:EXON 1|1-433:0| BL:SWS:NREP 1 BL:SWS:REP 68->423|AMIC_PSEAE|2e-44|30.9|356/385| SEG 2->26|ssgpsgssrssgssgssgsrilrrr| SEG 29->45|agtaalaavvalsacga| SEG 214->225|ankiikayakan| SEG 246->257|ankvkaakadav| BL:PDB:NREP 1 BL:PDB:REP 68->423|1qo0B|4e-44|30.3|356/374| RP:PDB:NREP 1 RP:PDB:REP 66->391|3cznA|4e-59|13.4|313/1014| RP:PFM:NREP 1 RP:PFM:REP 90->370|PF01094|5e-16|31.5|276/319|ANF_receptor| HM:PFM:NREP 2 HM:PFM:REP 87->401|PF01094|2.6e-11|17.4|311/348|ANF_receptor| HM:PFM:REP 24->45|PF10518|0.00053|50.0|22/26|TAT_signal| RP:SCP:NREP 1 RP:SCP:REP 64->405|1usgA|3e-52|18.8|336/345|c.93.1.1| HM:SCP:REP 65->430|1qo0A_|2.7e-100|38.3|366/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 721 OP:NHOMOORG 315 OP:PATTERN ------------------------1---1--2--------------------------------1--- ----1--2112----------2---2------21112321------------1---------2-1--2--1----1------1---------1-------------1--------------------------------11----32-12--111--211111111-111111-11111-1-1--11-1-----11111111-111111-1-----11-1-----------11-------------------------------11--------------------------------------------------111----1---21111111-1-----------1--1-----11-11--1----1--2------------12GIH--18797433333322311-4673284A-2--844323475424961--3-323222-1222222222---12-------------------------------------2642712356122222228433332144C344412444343115AC57C-21-2-1-----------1232141-1--11-1--1-2121112-1--1--2-31----------------------------1122----1-----------------12----1-1------1121-11------------------------------11111-------------------1---------111111111111------------112122---------------------1-1--222221112211211423----------------------11----------------2------------------------------------------------------2- -----------------------------------------------------------------------------------------------------------1--------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 379 STR:RPRED 87.5 SQ:SECSTR ###################################################cccHHHHHHEEccEEcTTEEEEEEEEEcccccTTEEEcEEEEEcccccccccTTcccccEEEccccEEEEcTTccEEEEcTTccEETccEEEEEccTTcccEEEEEEEEEEccccccccccccccccccccEEcccccccEEEEEcccccEEEEEEETTEEEEEEEcHHEEEEcccccEEEEEEccTTcTTEEEEEEEEEccccTTEEEEETTTEEEEEEccTTccGGGGcEEEccEEEEEcccEEEEEEEcccEEEEcccTTEEEEEEEEEccccccccccccccccccEEEEEEEEEEEcTTcccccTTccccHHHHHHHHHHHcccEEEEEcccccTccccEEEEEEcTTccEEEEEEccccTTccHHc#HHHHTcc## DISOP:02AL 1-27| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHccHHHHccEEEEEccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccEEEEEEcccccccccEEEEEEEEcccEEEEEEcccccccccccccccccccccc //