[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : lplB
DDBJ      :lplB         putative multiple sugar ABC transport permease protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  499/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:332 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   69->294 3fh6F PDBj 4e-10 29.5 %
:RPS:PDB   219->256 3dhwA PDBj 6e-09 28.9 %
:RPS:SCOP  86->325 2r6gG1  f.58.1.1 * 1e-17 16.6 %
:RPS:PFM   201->256 PF00528 * BPD_transp_1 4e-06 44.6 %
:HMM:PFM   121->326 PF00528 * BPD_transp_1 3.7e-23 25.0 180/185  
:BLT:SWISS 65->325 YTEP_BACSU 1e-69 46.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69166.1 GT:GENE lplB GT:PRODUCT putative multiple sugar ABC transport permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1794256..1795254) GB:FROM 1794256 GB:TO 1795254 GB:DIRECTION - GB:GENE lplB GB:PRODUCT putative multiple sugar ABC transport permease protein GB:NOTE malG, PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC69166.1 LENGTH 332 SQ:AASEQ MTSPTAVDPTPGARNPSPSEHTAPRPRRRPAPRRTWRQALRRDWQLYSLVVLPLLFLLVFRYLPMIGNAIAFRRFEPGGSMLGERWVGLRYVRMFLTDPTFWQVFTNTMWLGALTLVFCFPVPIVLALLLNEVRTRALKRFVQSVSYLPHFLSIVIVAGVTMQMLATDGPVNHALKAFGQAPVRFLQEPDWFRAVYVGSEIWQTAGWGTILYLAALTTIDEDLYEAARIDGAGRWKQIWHVALPGIRPTMITLLILNIGTFMAVGFEKVLLLYNPLTYPTADVISTYLYRTGVESNSFSYAAAIGLFEAVIGLVLIFSANQLSRRTVGTSLW GT:EXON 1|1-332:0| BL:SWS:NREP 1 BL:SWS:REP 65->325|YTEP_BACSU|1e-69|46.0|261/321| TM:NTM 6 TM:REGION 48->70| TM:REGION 111->133| TM:REGION 146->168| TM:REGION 203->225| TM:REGION 253->275| TM:REGION 298->320| SEG 23->34|aprprrrpaprr| SEG 46->64|lyslvvlpllfllvfrylp| BL:PDB:NREP 1 BL:PDB:REP 69->294|3fh6F|4e-10|29.5|220/316| RP:PDB:NREP 1 RP:PDB:REP 219->256|3dhwA|6e-09|28.9|38/203| RP:PFM:NREP 1 RP:PFM:REP 201->256|PF00528|4e-06|44.6|56/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 121->326|PF00528|3.7e-23|25.0|180/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 86->325|2r6gG1|1e-17|16.6|223/284|f.58.1.1| OP:NHOMO 2177 OP:NHOMOORG 516 OP:PATTERN ----2-----------3-------5116--3------------------------21-11--11---- ---1V213333-1112233-31224333333411-112245224GyT29992FEA-16--7369C35LOD47333D851---4-----------------------------------------------------68866---53221311-11221111122221333--1-----1----98165AC-943222222331132223OI664722454B28336566559*-11111111111111-1---531-11--11111--11-----322212143333--555556555553233333332233233---3334E4--81111111413D2--1333b-26123B--121--1F--1675F1-1--------1-----A751--2133134443544448---4--2-16E--PHH8QOHYURJI-1---5634334741--------1--1--12-----------------------------1---2--1111333333312222243333222235112---1115-122112347----1--2--------------1----------1111---------221212-----------------------------124-------2---------------------------------55412-1111111111-111111121111-11111-1215511--2--------------3-1-1111--377767777666-------------1-639-----1--------1------------11211111111112-22-----------11--11112-22211111111111111-------------------13--1----1--11--------21---7IC967M697-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1-------2--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 73.2 SQ:SECSTR ####################################################################TTccccccccccccHHHHHHHTTHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHcccHHHHHHHHHHccccc###cHHHHHHHHcccccccc#ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHTcHHHHcccccccccccccccHcccHHHHHHHTTccHHHHHHHHHHTHHHHHHHHHH################# DISOP:02AL 1-3, 8-41, 330-332| PSIPRED ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //