[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : lysA2
DDBJ      :lysA2        putative diaminopimelate decarboxylase
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  787/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
b.49.2c.1.6
:466 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->464 1hkvA PDBj e-100 45.3 %
:RPS:PDB   60->463 3c5qA PDBj 2e-57 26.2 %
:RPS:SCOP  75->323 1hkvA2  c.1.6.1 * 1e-44 45.0 %
:RPS:SCOP  297->464 1hkvA1  b.49.2.3 * 2e-35 41.1 %
:HMM:SCOP  68->332 1twiA2 c.1.6.1 * 1.2e-72 42.7 %
:HMM:SCOP  302->467 1knwA1 b.49.2.3 * 1.3e-48 45.1 %
:RPS:PFM   84->323 PF02784 * Orn_Arg_deC_N 1e-37 45.0 %
:RPS:PFM   350->442 PF00278 * Orn_DAP_Arg_deC 5e-14 39.8 %
:HMM:PFM   75->330 PF02784 * Orn_Arg_deC_N 8.8e-59 34.4 247/251  
:HMM:PFM   335->442 PF00278 * Orn_DAP_Arg_deC 4.7e-23 31.5 108/116  
:BLT:SWISS 39->464 DCDA_MYCTU 2e-99 45.3 %
:PROS 97->115|PS00878|ODR_DC_2_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68626.1 GT:GENE lysA2 GT:PRODUCT putative diaminopimelate decarboxylase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1094980..1096380 GB:FROM 1094980 GB:TO 1096380 GB:DIRECTION + GB:GENE lysA2 GB:PRODUCT putative diaminopimelate decarboxylase GB:NOTE PF02784: Pyridoxal-dependent decarboxylase, pyridoxal binding domain GB:PROTEIN_ID BAC68626.1 LENGTH 466 SQ:AASEQ MSVSVPSSLPSALPPSVPALPPSDPQTLSRLLGDTDGLSVWPRSARPEADGDVCVGGVSLTEAADRFGTPVYVLDEQEVRERCRTYRTAFPEADVVYAAKAFLCRAMAHWVQEEGLGLDVCSAGELALAVTTGFPPEKIVMHGNAKSPEDLRTALRLGVGRIVVDSASEIARLAAITPCDTRQKVMVRVVPGIAAGGHTKIRTGTDDQNFGLSLTDGSAQHAITRILDQPHLELVGLHCHIGSQIAAVKPYVAAVRRMVGLMARVRDQHGVILPQLNIGGGHAIAYRPGDETMNVGVLAGRVRAELEDGCARARLPVPRLTIEPGRAVVGPAGVAVYRVLAVKRTGEHTFVAVDGGMSDNPRPALYGVRYAPRLIGRPSSAPSRFVTVVGRHCEAGDVLADGVALPGDVRPGDLLAVPAAGAYHLSMTSGYNLVGRPPVVAVSDGIARVLVRRESLDDMSRRDVGL GT:EXON 1|1-466:0| BL:SWS:NREP 1 BL:SWS:REP 39->464|DCDA_MYCTU|2e-99|45.3|426/447| PROS 97->115|PS00878|ODR_DC_2_1|PDOC00685| SEG 2->23|svsvpsslpsalppsvpalpps| SEG 324->339|pgravvgpagvavyrv| BL:PDB:NREP 1 BL:PDB:REP 39->464|1hkvA|e-100|45.3|426/446| RP:PDB:NREP 1 RP:PDB:REP 60->463|3c5qA|2e-57|26.2|386/394| RP:PFM:NREP 2 RP:PFM:REP 84->323|PF02784|1e-37|45.0|231/249|Orn_Arg_deC_N| RP:PFM:REP 350->442|PF00278|5e-14|39.8|93/139|Orn_DAP_Arg_deC| HM:PFM:NREP 2 HM:PFM:REP 75->330|PF02784|8.8e-59|34.4|247/251|Orn_Arg_deC_N| HM:PFM:REP 335->442|PF00278|4.7e-23|31.5|108/116|Orn_DAP_Arg_deC| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02784|IPR000183| GO:PFM GO:0003824|"GO:catalytic activity"|PF00278|IPR000183| RP:SCP:NREP 2 RP:SCP:REP 75->323|1hkvA2|1e-44|45.0|249/265|c.1.6.1| RP:SCP:REP 297->464|1hkvA1|2e-35|41.1|168/181|b.49.2.3| HM:SCP:REP 68->332|1twiA2|1.2e-72|42.7|262/0|c.1.6.1|1/1|PLP-binding barrel| HM:SCP:REP 302->467|1knwA1|1.3e-48|45.1|164/0|b.49.2.3|1/1|Alanine racemase C-terminal domain-like| OP:NHOMO 1190 OP:NHOMOORG 876 OP:PATTERN -----------------1-----11--111111111111111112111112221---1---1111--- 1111411111111122211-11111211111122222211121111111111111111--321132333311111111111212121111121112-11111-1121111---------------1111111112111111111111111111111111211111111121111111111111111--1111111111111111111111111111111111111111111211222222222222221111111--1111-1-111111-11111111-------11111111111111-------------111111111111-11111111111132112111-11--1211111121111111121--1122111132222212232222222222222222222-3323333222113223222222222211112211111112222222212221121---11111---------------------1222111111111112111111113111111212211121111211211112211112211111111111134322311311112121333122212111111112211111111111111111111111112111222121311122222222122222212211---2221-1----11231111111111111-1111111111111111111111111212222222222222222111111111-11111111111111-2-1---11111111311111111111111111121112213122223322233322332112122221211111111112122112222222211111111111111----------1-------------------------2232212111121 ----22--1--1---------1-----------111-----------1-----1----1------------------------------------------------2121-1-----1---1------211--11--1--------1-----1----2----111-------3213119111112122-21-122121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 426 STR:RPRED 91.4 SQ:SECSTR ######################################TTccTTEEEHHcccccHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHTccccEEEEGGGcccHHHHHHHHHTTcEEEEccHHHHHHHHHHTccGGGEEEccTTccHHHHHHHHHTTccEEEEccHHHHHHHHHHHHHTccEEEEEEccccccccccGGGccccTTccccccHHHHHHHHHHHHHHHcTTEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHTHTTccccEEEccccccccTTccccccHHHHHHHHHHHHHTccHHHTTTcccEEEEcccHHHHTTTEEEEEEEEEEEccccEEEEEEcccTTTccHHHHHcccccEEEcccEEcccEEEEEEEcccccTTcEEEEEEEEEccccTTcEEEEcccccccGGGcccTTTccccEEEEEEcccEEEEEccccHHHHHGGGE## DISOP:02AL 1-25| PSIPRED cEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHccccEEEEcHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccEEEEcccccHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHcccEEEEEEEEEEEEcccEEEEEEcccccccccHHHHcccccEEEEcccccccEEEEEEEEcccccccEEEEEcccccccccccEEEEEcccHHHHHHHcccccccccEEEEEEcccEEEEEEEccHHHHHHHHccc //