[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : melC1
DDBJ      :melC1        tyrosinase co-factor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->117 2zmzB PDBj 2e-18 65.8 %
:RPS:PFM   42->117 PF06236 * MelC1 1e-14 48.7 %
:HMM:PFM   11->117 PF06236 * MelC1 4.1e-45 61.7 107/125  
:BLT:SWISS 42->117 TYRT_STRGA 2e-17 77.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68846.1 GT:GENE melC1 GT:PRODUCT tyrosinase co-factor protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1424869..1425225 GB:FROM 1424869 GB:TO 1425225 GB:DIRECTION + GB:GENE melC1 GB:PRODUCT tyrosinase co-factor protein GB:NOTE melanin biosynthesis, PF00264: Common central domain of tyrosinase GB:PROTEIN_ID BAC68846.1 LENGTH 118 SQ:AASEQ MPELTRRHALGAAAALAAVAGTQALAAPSASAAGHHGGPQPFDEVYQGRRIEGRATGGGHHHGSGYGVFIDGMELHVMQNVDGSWISVVSHYDPVATPRAAARAAVVELQGAPLVPFN GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 42->117|TYRT_STRGA|2e-17|77.6|76/134| SEG 9->40|algaaaalaavagtqalaapsasaaghhggpq| SEG 57->67|ggghhhgsgyg| SEG 94->107|pvatpraaaraavv| BL:PDB:NREP 1 BL:PDB:REP 42->117|2zmzB|2e-18|65.8|73/79| RP:PFM:NREP 1 RP:PFM:REP 42->117|PF06236|1e-14|48.7|76/123|MelC1| HM:PFM:NREP 1 HM:PFM:REP 11->117|PF06236|4.1e-45|61.7|107/125|MelC1| GO:PFM:NREP 2 GO:PFM GO:0005507|"GO:copper ion binding"|PF06236|IPR010928| GO:PFM GO:0042438|"GO:melanin biosynthetic process"|PF06236|IPR010928| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 61.9 SQ:SECSTR #########################################EEEEETTEEEEEEEcccccccEE###EEETTEEEcEEEcTTccEEETTEEEEEEccHHHHHHHHHHHHTTcccccc# DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccEEEccccccccccccEEEEEEccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHccccccccc //