[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : melC2
DDBJ      :melC2        tyrosinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
a.86.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->274 2zmxA PDBj e-137 80.6 %
:RPS:PDB   1->274 1bt1A PDBj 2e-26 21.5 %
:RPS:SCOP  3->274 1js8A1  a.86.1.1 * 6e-31 21.2 %
:HMM:SCOP  1->274 1lnlA1 a.86.1.1 * 4.8e-65 38.4 %
:RPS:PFM   54->228 PF00264 * Tyrosinase 2e-19 38.9 %
:HMM:PFM   30->228 PF00264 * Tyrosinase 8.3e-48 33.3 198/228  
:BLT:SWISS 1->273 TYRO_STRGA e-140 81.3 %
:PROS 54->71|PS00497|TYROSINASE_1
:PROS 209->220|PS00498|TYROSINASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68847.1 GT:GENE melC2 GT:PRODUCT tyrosinase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1425261..1426085 GB:FROM 1425261 GB:TO 1426085 GB:DIRECTION + GB:GENE melC2 GB:PRODUCT tyrosinase GB:NOTE melanin biosynthesis, PF06236: Tyrosinase co-factor MelC1 GB:PROTEIN_ID BAC68847.1 LENGTH 274 SQ:AASEQ MTVRKNQATLTADEKRRFVDALVALKRSGRYDEFVTTHNAFIMGDTDSGERTGHRSPSFLPWHRRFLIEFEQALQAVDPSVALPYWDWSTDRTARASLWAPDFLGGSGRSLDGRVMDGPFAASTGNWPVNVRVDSRTYLRRTLGGGGRELPTRAEVDSVLAMSTYDMAPWNSASDGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYIDRLWAQWQSRHPGSGYVPTGGTPNVVDLNETMKPWNDVRPADLLDHTAHYTFDTV GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 1->273|TYRO_STRGA|e-140|81.3|273/274| PROS 54->71|PS00497|TYROSINASE_1|PDOC00398| PROS 209->220|PS00498|TYROSINASE_2|PDOC00398| SEG 136->153|rtylrrtlggggrelptr| BL:PDB:NREP 1 BL:PDB:REP 2->274|2zmxA|e-137|80.6|273/277| RP:PDB:NREP 1 RP:PDB:REP 1->274|1bt1A|2e-26|21.5|265/336| RP:PFM:NREP 1 RP:PFM:REP 54->228|PF00264|2e-19|38.9|167/205|Tyrosinase| HM:PFM:NREP 1 HM:PFM:REP 30->228|PF00264|8.3e-48|33.3|198/228|Tyrosinase| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00264|IPR002227| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00264|IPR002227| RP:SCP:NREP 1 RP:SCP:REP 3->274|1js8A1|6e-31|21.2|241/281|a.86.1.1| HM:SCP:REP 1->274|1lnlA1|4.8e-65|38.4|258/307|a.86.1.1|1/1|Di-copper centre-containing domain| OP:NHOMO 147 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- -------1---------------------------------111-----------------------313------------1--------------------------------------------------------------------------------------2------------------------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1---------------1----------------------------------------------------------------------------------------------------------1-----------------1---------------------------1-2---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------- ----2-------B9-1-12----2-2-111211-------------1---21----32-1---------------------------------2-1------------1-F221212-----1----1-141-111--1-1-11-1-----111--1-2--1-21------553---------------1----1--12 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 100.0 SQ:SECSTR cEEEccGGGccHHHHHHHHHHHHHHHTccTTcTTcHHHHHHHccccTTccccccccTTHHHHHHHHHHHHHHHHHHHccccccccccTTcGGGccccGGGGcTTcTTccccccTTccTTccccTTcccccccccHHHHHHHHHHHHHHHHTGGGccHHHHHcccccTTTcTccccccccHHHHTccccTHHHHHHHHccTTcTTTGGGcHHHHHHHHHHHHHHHHHHTcccccccHHHHTcETcEEEEcTTccEEEEEGGGGccTGGTEEEccc DISOP:02AL 274-275| PSIPRED ccccccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHccccccccccccHHEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccccc //