[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : mhpA
DDBJ      :mhpA         putative 3-(3-hydroxy-phenyl)propionate hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  191/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:536 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   150->352 2r0pA PDBj 4e-13 31.9 %
:RPS:PDB   26->352 3c96A PDBj 7e-23 17.0 %
:RPS:SCOP  130->352 3c96A1  c.3.1.2 * 3e-14 13.8 %
:HMM:SCOP  5->412 1k0iA1 c.3.1.2 * 9.8e-57 33.8 %
:RPS:PFM   99->350 PF01494 * FAD_binding_3 6e-10 37.1 %
:RPS:PFM   386->418 PF02005 * TRM 6e-04 54.8 %
:HMM:PFM   8->359 PF01494 * FAD_binding_3 9.3e-69 32.2 342/356  
:BLT:SWISS 24->515 MHPA_BURCH 7e-47 35.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68273.1 GT:GENE mhpA GT:PRODUCT putative 3-(3-hydroxy-phenyl)propionate hydroxylase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(713315..714925) GB:FROM 713315 GB:TO 714925 GB:DIRECTION - GB:GENE mhpA GB:PRODUCT putative 3-(3-hydroxy-phenyl)propionate hydroxylase GB:NOTE Rif19 homolog, PF01494: FAD binding domain GB:PROTEIN_ID BAC68273.1 LENGTH 536 SQ:AASEQ MKAASQRPVVIIGGGPVGVMAGLLLARYGVRSLLLERHRDIYPLPRAVVVDDEIRRILQSVGVHEDFAALARPALGLRLLDARRRVITEFPRSMHGHHGFPETSMFDQPELERVLRSALARRPECELQGGVEVVSVTQDTDGPNDPTGPARVTFRRDGSDEEEHVWADAVLGCDGAGSLTRDSIGAVWEDLHFQESWRVIDVRTTRQVRTWEGAEQICCPNRPATFMRVGEDRYRWEFRLPEDENLDGPDGWERLRELVAPWVDLPPDASAGDDFEVVRQAQYTFRARLADRWRRGRVFLLGDAAHLTPPFVGQGLCAGLRDAYNLTWKLARVLQQGAHDGLLDTYERERKPHARHVIRVAVAVGWAMTGGQDRGAAFRRAVVGTASRIPGVTAAVSRDLSPALTAGPLVRRRPRLTGRVLAGTICPQPWVRHDGRRVRLDDVLGDSFAVVTAVPPTAQMTAVATALGAPTVHVEDLRDDGTLAGWLARGRADAVLLRPDRVVMDTVQAGTGDFTDTVAWAPLLHTARHTADARPA GT:EXON 1|1-536:0| BL:SWS:NREP 1 BL:SWS:REP 24->515|MHPA_BURCH|7e-47|35.3|468/542| SEG 8->19|pvviigggpvgv| SEG 68->85|aalarpalglrlldarrr| SEG 286->297|rarladrwrrgr| SEG 353->364|harhvirvavav| BL:PDB:NREP 1 BL:PDB:REP 150->352|2r0pA|4e-13|31.9|188/512| RP:PDB:NREP 1 RP:PDB:REP 26->352|3c96A|7e-23|17.0|317/381| RP:PFM:NREP 2 RP:PFM:REP 99->350|PF01494|6e-10|37.1|232/338|FAD_binding_3| RP:PFM:REP 386->418|PF02005|6e-04|54.8|31/377|TRM| HM:PFM:NREP 1 HM:PFM:REP 8->359|PF01494|9.3e-69|32.2|342/356|FAD_binding_3| GO:PFM:NREP 5 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| GO:PFM GO:0003723|"GO:RNA binding"|PF02005|IPR002905| GO:PFM GO:0004809|"GO:tRNA (guanine-N2-)-methyltransferase activity"|PF02005|IPR002905| GO:PFM GO:0008033|"GO:tRNA processing"|PF02005|IPR002905| RP:SCP:NREP 1 RP:SCP:REP 130->352|3c96A1|3e-14|13.8|210/269|c.3.1.2| HM:SCP:REP 5->412|1k0iA1|9.8e-57|33.8|290/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 470 OP:NHOMOORG 241 OP:PATTERN -------------------------------------------------------------------- --116--1111---553----2--55------44442398-416-11-----121-----381-3274412-----------1---------------------------------------------------------------------------------------------------------------11111-11-1111-------1111----1------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------3531--11111------------11-112-1-12----2111131-1241--241-----11------------1----------------------------------14--211132455342222244342222225462531--11111---213-42--1----------------11-1---------------------------46----------------------------------2--------------------------------------------111-1---11-11111-11111-111-11-111--11-1----1111---1----------1-------------------1----11111-----------------------------------112----1-1-1------------------------11----------------------------------------------------------------------- ----11---------121-23536356221111----111-111111-11-134--31-------------------------------1-12-41------1-----1-------------------------------------------------1---------------------111-11----11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 484 STR:RPRED 90.3 SQ:SECSTR ###################HHHHHHHTTccEEEEEEccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEcGGGGTccccEEHEEEHHHHHHHHHHHHHHHcTTcEEEcEEEEEEEEETTEEEEcTTcEEEEEEEETTccEEEEEEcEEEEcccTTcHHHHHHcEEEEEcccTTccEEEEEEcTTccEEEEEEccHHHTTTcEEEEEEEEEEHHHHccccccccTTccccHHHHHHHHTTcccTTccHHHHHHTccEEEEEEEEEcccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHTcccccHHHHHHHHHHTTcccccccGGGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHTcTTTcEEEEcTTccE################################# DISOP:02AL 1-4, 531-536| PSIPRED ccccccccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEcHHHHHHHHHcccHHHHHHHcccEEEEEEEEccccEEEEccccccccccccEEEEEcHHHHHHHHHHHHHHccccEEEEccEEEEEEEccccccccccccEEEEEEcccccEEEEEEEEEEEEccccHHHHHHcccccccccccEEEEEEEEEccccccccccEEEEEccccEEEEEEEccccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccEEEEEccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccccccEEEcccccEEEHHHHcccEEEEEEccccccHHHHHHHccccEEEEEEEccccHHHHHHccccccEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccc //