[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : nrps7-10
DDBJ      :nrps7-10     putative non-ribosomal peptide synthetase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  157/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.43.1
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   125->349 2jgpA PDBj 3e-14 27.4 %
:RPS:PDB   117->432 3b2sA PDBj 4e-24 12.6 %
:RPS:SCOP  32->199 1l5aA1  c.43.1.2 * 6e-19 15.7 %
:RPS:SCOP  209->452 1l5aA2  c.43.1.2 * 1e-22 11.5 %
:HMM:SCOP  30->215 1l5aA1 c.43.1.2 * 5.4e-33 32.4 %
:HMM:SCOP  206->448 1l5aA2 c.43.1.2 * 1.3e-27 29.6 %
:RPS:PFM   32->315 PF00668 * Condensation 3e-12 27.5 %
:HMM:PFM   29->305 PF00668 * Condensation 3.1e-37 27.8 273/301  
:BLT:SWISS 122->349 LGRB_BREPA 8e-22 29.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68569.1 GT:GENE nrps7-10 GT:PRODUCT putative non-ribosomal peptide synthetase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1025128..1026513 GB:FROM 1025128 GB:TO 1026513 GB:DIRECTION + GB:GENE nrps7-10 GB:PRODUCT putative non-ribosomal peptide synthetase GB:NOTE nrps7 gene cluster GB:PROTEIN_ID BAC68569.1 LENGTH 461 SQ:AASEQ MVGDEQIAALVRHYAGRPAALGGSSAATALSPQQSDLWRAARPLVSTPVFLATVVFRLRGPVHRTALAAAVRRLSLRHDLLRTVFENGPAPAAHLGEPPELRVVEAPDAAADTAEELVRGIARTPFRFGEEPLFRVTLVCRAEDDYLLVLTCHQLVIDGYGQSLLLQEFTSLYRAEIRGEPDDLPEIKQPYRETARLLRNPDPEVRRGDEEFWTSRLRDLPVMSLPGDRPGPEGATLAPTGAVETVLPDPDGAVVAGLRRLRVNLFALFAAGTMAMLHGYTGQTDLWVATVVDNRLTPESQAHVGPLAGPRVVRVGFAADATFGVLARAVQREVWATMERQHIPFHDVITAATGDGADMRNLGSVGITVTPSIQLPDWPLGDMEPLEFDPLEGEPSTGSPLALLVEEQAGRYRLRLEFDESRFSHGRAHDMMTTIADAVVAATADPQRSLASWRGPTSADD GT:EXON 1|1-461:0| BL:SWS:NREP 1 BL:SWS:REP 122->349|LGRB_BREPA|8e-22|29.9|224/5162| SEG 19->31|aalggssaatals| SEG 64->77|rtalaaavrrlslr| SEG 105->116|eapdaaadtaee| SEG 433->445|ttiadavvaatad| BL:PDB:NREP 1 BL:PDB:REP 125->349|2jgpA|3e-14|27.4|215/520| RP:PDB:NREP 1 RP:PDB:REP 117->432|3b2sA|4e-24|12.6|309/448| RP:PFM:NREP 1 RP:PFM:REP 32->315|PF00668|3e-12|27.5|280/297|Condensation| HM:PFM:NREP 1 HM:PFM:REP 29->305|PF00668|3.1e-37|27.8|273/301|Condensation| RP:SCP:NREP 2 RP:SCP:REP 32->199|1l5aA1|6e-19|15.7|166/174|c.43.1.2| RP:SCP:REP 209->452|1l5aA2|1e-22|11.5|234/250|c.43.1.2| HM:SCP:REP 30->215|1l5aA1|5.4e-33|32.4|173/0|c.43.1.2|1/1|CoA-dependent acyltransferases| HM:SCP:REP 206->448|1l5aA2|1.3e-27|29.6|233/0|c.43.1.2|1/1|CoA-dependent acyltransferases| OP:NHOMO 580 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- 2---7---------12111-1---4311111-1---749B--21---------1------A4--B356-91------------------------------6---A-----------------------1--------------D-356-787--------------96H1----------------------911111211-11122---3357-14---1---------E-----------------11-------------------------------------1-------------------------------------------2-----8-22------1--------------------------1---------322-8----2---------------11-11-1-2----335------2--2---------------------------------------------------------------------1111144333111215553--1111-------2--1--2---4-------------------3-------------------------------K5----------------------------------1-------------------------------------2-3-------2-22--------------------------2-4A------------------------------------------------------2-1---------------11111-----434434858624544-A7E-----------------------------------------------------------------------------------------------4- --------------1------1-122---------1-------------3-1-1--1--------------------------------1----2--------------1------------------------------------------------1-------------------------1---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 85.9 SQ:SECSTR ####################################TTTTcccEEEEEEEEccccHHHHHHTHHHHHHHHHHHHHHHcGGGGcEEEEccccccccEEEEGTcccccEEGGGcGGGcccccccccTTcccccccEEEEEEEEEcTEEEEEEEEETTTccHHHHHHHHHHHHHHHHTEEHTccccHHHHHHTTcccTTcccccTTccccGGTTccccTTccccccccccccEEEEEEEEcHHHHHHHHHHTTccTTcccccHHHHHHHHHHHHHHHHHTTTccTTcEEEEEEEEEcHHHHTccTTccccEEEEEEEHHHHHHccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHccccTTccEETTTTccTTTcEEEEEcTTccGGGccTTccccccccTTEEEEccccTTccEEEEEEEEHHHHHHHHHcHHH############################# DISOP:02AL 13-24, 458-461| PSIPRED cccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEccccEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEEEEccccEEEEEEccHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccEEEEEEEEcccccccccccccccEEEEEcccccccccEEEEEEEcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccc //