[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : nrps7-3
DDBJ      :nrps7-3      putative non-ribosomal peptide synthetase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  659/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
a.28.1e.23.1
:574 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->462 2vsqA PDBj 6e-37 28.6 %
:RPS:PDB   34->462 3e7wA PDBj 1e-40 26.3 %
:RPS:PDB   515->545 2cgqA PDBj 3e-04 12.9 %
:RPS:SCOP  34->462 1md9A  e.23.1.1 * 8e-37 21.0 %
:RPS:SCOP  515->545 1dnyA  a.28.1.2 * 2e-05 25.8 %
:HMM:SCOP  26->498 1pg4A_ e.23.1.1 * 3e-120 37.3 %
:HMM:SCOP  482->557 1dnyA_ a.28.1.2 * 2.5e-14 35.5 %
:RPS:PFM   34->407 PF00501 * AMP-binding 4e-28 37.9 %
:HMM:PFM   26->407 PF00501 * AMP-binding 2.5e-93 34.0 373/418  
:HMM:PFM   492->555 PF00550 * PP-binding 2.3e-15 29.7 64/67  
:HMM:PFM   464->476 PF12107 * VEK-30 0.00013 69.2 13/17  
:BLT:SWISS 34->545 LGRC_BREPA 4e-51 34.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68556.1 GT:GENE nrps7-3 GT:PRODUCT putative non-ribosomal peptide synthetase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1002287..1004011) GB:FROM 1002287 GB:TO 1004011 GB:DIRECTION - GB:GENE nrps7-3 GB:PRODUCT putative non-ribosomal peptide synthetase GB:NOTE nrps7 gene cluster GB:PROTEIN_ID BAC68556.1 LENGTH 574 SQ:AASEQ MTAFAGTSVRAEQDSTAAALARQQAGLLITSPADFVVALYGAWEAGLGVLPLPVDFPDERLRHMVEDCRPAALIASADQADRAARLAAVAQPAIEVVVLDAVADGDEHAPGPSRSHVPEIPDAAAFTVYTSGSTGRPKGVLIRHEQIGRLIAWCADTWQLGPWARVAQTLSLGFDFGLQELFTFLPFGGCVVVPGQEDRLSARAYARFLRRERVSVLFTTPSFADELIAAGEPLPDLRLVLLGGEVLKGVTAEGMRVLAAPDCRLFNGYGPTEATVNCLMYEIPRPPEGAEPPRLVPVGSATAAARIDLVDEQGRPVPVGALGEIRIGGPGVADGYLRRPELTAERFVRCQDTDEVLYRTGDLAYARHDGVFVVVGRADRQVKIRGHRAELGEIERTLRSAPGVVSAEVRVIGTPARLVAYLVGTGIDLGAVRDHVAARLPPAMLPEQGVLLERLPTTANGKLDEAALERLAEERHAQRLPDAASPAEIEAAVCAAWAAALAAPDVAPDVNVFDLGAHSLVVTRVHGRISAALGVDFPVHEVFEYPRPRDLARRLAALRRVDRDGPPTPWQLRQ GT:EXON 1|1-574:0| BL:SWS:NREP 1 BL:SWS:REP 34->545|LGRC_BREPA|4e-51|34.0|488/7756| TM:NTM 2 TM:REGION 31->53| TM:REGION 486->508| SEG 17->28|aaalarqqagll| SEG 70->94|paaliasadqadraarlaavaqpai| SEG 237->250|lrlvllggevlkgv| SEG 463->514|ldeaalerlaeerhaqrlpdaaspaeieaavcaawaaalaapdvapdvnvfd| SEG 546->564|prprdlarrlaalrrvdrd| BL:PDB:NREP 1 BL:PDB:REP 34->462|2vsqA|6e-37|28.6|416/1273| RP:PDB:NREP 2 RP:PDB:REP 34->462|3e7wA|1e-40|26.3|415/508| RP:PDB:REP 515->545|2cgqA|3e-04|12.9|31/74| RP:PFM:NREP 1 RP:PFM:REP 34->407|PF00501|4e-28|37.9|338/405|AMP-binding| HM:PFM:NREP 3 HM:PFM:REP 26->407|PF00501|2.5e-93|34.0|373/418|AMP-binding| HM:PFM:REP 492->555|PF00550|2.3e-15|29.7|64/67|PP-binding| HM:PFM:REP 464->476|PF12107|0.00013|69.2|13/17|VEK-30| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 2 RP:SCP:REP 34->462|1md9A|8e-37|21.0|414/536|e.23.1.1| RP:SCP:REP 515->545|1dnyA|2e-05|25.8|31/76|a.28.1.2| HM:SCP:REP 26->498|1pg4A_|3e-120|37.3|459/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| HM:SCP:REP 482->557|1dnyA_|2.5e-14|35.5|76/76|a.28.1.2|1/1|ACP-like| OP:NHOMO 4794 OP:NHOMOORG 848 OP:PATTERN -------343444362--2243212--2--33--2---333216214511233--------12----- 2123Q643223634IMFBB-AB11QLBBBBBBFEDEPanh1NAF3-12-4--325225--MK62bBROGT4---------425--21-3322-1-------8--1F-1-2--------------1----1----115668B---Y268B1DDC--1111111-1-14F9R1-1-1---2-11-32153--141J44545837446579413888F34B344951-222221O3122222232222222222112111111112113111111111-111111112115411111111111111111111111111112211121---51111511112H266------41-4112-652-31--331111---4-44336-----66D9I214CIDBC2212222122--666769774B3-688B443348876B13374C32445571111111151--1423------------------------------66G4-69A5A7BCBDEKDGGB778BTUUTAND7JIPTD--65C15B44F46AHC1-31---6111111111146331831233545-442-35332-2253343XF2411-1-111111------------13--5412141-3-121111921---13-11125--12522------91G95223337388322-224231313323322322111288OP1323233333342322452312212--243434311232---213121333233Q29-1-------------5556513112A4FHCGOGEE5A8B93GHM2--------1---72233221-2244523231111111-------------------1------------------------------------271 ----121-----65AFFK8NMZOYYVXDCCCABLOLCBCBACB99BFAFYOLHKGBKI956621111211211112111121111-23-5A2F5712121318756-2926-1--13-------6---15B3-21--------1--11-----7--1-61131B38323562298---1T21241965JM332254228 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 461 STR:RPRED 80.3 SQ:SECSTR ################################THHHHHHHHHHHHTccEEEEETTccHHHHHHHHHHHTccEEEEcccccTTccccHTTcccEEccccEEEHHHHHTcccccccGGGcccTTcEEEEEEEccTTcccEEEEEEHHHHHHHHHHHHHHcTTTTTcEEEEcccTTcTHHHHHHHHHHHTTcEEEEccHHHHHcHHHHHHHHHHHcccEEEEcHHHHHHHHTcTTccTTcTTccEEEEccccccHHHHHHHHcTTcEEEEccccGGGccccEEEEEcHHHHTTcTcccccccEEcTTcEEEEEcTTcccccTTccEEEEEEcTTcccccTTcHHHHHHHEEEccccETEEEEEEEEEEEEETTEEEEEEEcccEEEETTEEEEHHHHHHHHHHcTTEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHccGGGcccEEEEcccccccTTcc####################################################TcccHHHHHHHHHHHHHHHTccccHHHHHHc############################# DISOP:02AL 474-487, 555-569, 571-574| PSIPRED cccHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHcccEEEEEcHHHHHHHHHHccccccccEEEEcccccccccccccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHccEEEEEccHHcccHHHHHHHHHHccccEEEEcHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccEEEEccccccHHHcEEEEEcccccccccccccccccEEccccEEEEEcccccccccccEEEEEEcccHHHHHHcccHHHHHHHHccccccccccEEEccEEEEccccEEEEEEccccEEEEccEEEcHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHcHHHccccEEEEccccccccccHHHHHHHHcHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHcccccccccccHHHcc //