[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : nrps7-6
DDBJ      :nrps7-6      putative non-ribosomal peptide synthetase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  239/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
a.28.1c.43.1
:550 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->440,474->546 2jgpA PDBj 5e-53 31.3 %
:RPS:PDB   1->426 3b30A PDBj 1e-51 12.2 %
:RPS:PDB   444->497 2atwA PDBj 1e-04 13.2 %
:RPS:PDB   474->548 1dnyA PDBj 6e-14 29.3 %
:RPS:SCOP  7->184 1l5aA1  c.43.1.2 * 4e-35 21.8 %
:RPS:SCOP  190->440 1l5aA2  c.43.1.2 * 9e-40 13.0 %
:RPS:SCOP  474->548 1dnyA  a.28.1.2 * 6e-17 29.3 %
:HMM:SCOP  7->199 1l5aA1 c.43.1.2 * 1.3e-43 46.6 %
:HMM:SCOP  188->450 1l5aA2 c.43.1.2 * 3e-46 34.7 %
:HMM:SCOP  473->548 1dnyA_ a.28.1.2 * 1.5e-16 48.7 %
:RPS:PFM   6->300 PF00668 * Condensation 4e-45 46.0 %
:RPS:PFM   484->546 PF00550 * PP-binding 2e-06 41.3 %
:HMM:PFM   2->302 PF00668 * Condensation 3e-59 31.9 295/301  
:HMM:PFM   483->546 PF00550 * PP-binding 5.1e-14 35.9 64/67  
:BLT:SWISS 2->440,444->547 LGRB_BREPA 3e-67 36.3 %
:PROS 505->520|PS00012|PHOSPHOPANTETHEINE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68562.1 GT:GENE nrps7-6 GT:PRODUCT putative non-ribosomal peptide synthetase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1014084..1015736) GB:FROM 1014084 GB:TO 1015736 GB:DIRECTION - GB:GENE nrps7-6 GB:PRODUCT putative non-ribosomal peptide synthetase GB:NOTE nrps7 gene cluster GB:PROTEIN_ID BAC68562.1 LENGTH 550 SQ:AASEQ MEDNAPLSFGQEALWLAEELVPGLSAYVMLAGWELTGPLDPQALQRALTALVDRHELLRSALVPVDGRPEQVIRGCAPFELRRVDLRDRDGQEQDNAIAGDLAGLLEKPFDLSSPPLLRGVLFRLAARRHTLVLVTHHIVWDGDSDVLLRRELSELYAAEVQGRRPQLPELTAQYADFAWWQREEASPALEASVEHWAQRLRDVRAPELPTDRPRPALRRFTAAFCQIPIPAAAVRGVTKLARTASVSPFVVHLAVFDVLLARWADEPRAVVGTPLAGRGEPELENLLGYFVNSVVLVADCDPGLTLSELLVAVRTDLSSAFEHGDAPFHHVVDRINPARDSSRHPLYQVAFQYVPESEPLRLIGVDVTEVSERLLHRSEVTTEFDLLAEVREEADGQHILNLRYATDLFDATTMDGVARAYVEILDAAVATPDSTLARLAEAAMSLPAAGTKPSRRPENVPHRVPSSDATPSVAPRTELHGRIAAVWAEVLGLPEVDCSANFFAMGGSSLLGAQLVRRLSAELGLNLELIDLFDSESVDGLVEFLGTAR GT:EXON 1|1-550:0| BL:SWS:NREP 1 BL:SWS:REP 2->440,444->547|LGRB_BREPA|3e-67|36.3|538/5162| PROS 505->520|PS00012|PHOSPHOPANTETHEINE|PDOC00012| BL:PDB:NREP 1 BL:PDB:REP 6->440,474->546|2jgpA|5e-53|31.3|491/520| RP:PDB:NREP 3 RP:PDB:REP 1->426|3b30A|1e-51|12.2|418/446| RP:PDB:REP 444->497|2atwA|1e-04|13.2|53/223| RP:PDB:REP 474->548|1dnyA|6e-14|29.3|75/76| RP:PFM:NREP 2 RP:PFM:REP 6->300|PF00668|4e-45|46.0|289/297|Condensation| RP:PFM:REP 484->546|PF00550|2e-06|41.3|63/67|PP-binding| HM:PFM:NREP 2 HM:PFM:REP 2->302|PF00668|3e-59|31.9|295/301|Condensation| HM:PFM:REP 483->546|PF00550|5.1e-14|35.9|64/67|PP-binding| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 3 RP:SCP:REP 7->184|1l5aA1|4e-35|21.8|170/174|c.43.1.2| RP:SCP:REP 190->440|1l5aA2|9e-40|13.0|238/250|c.43.1.2| RP:SCP:REP 474->548|1dnyA|6e-17|29.3|75/76|a.28.1.2| HM:SCP:REP 7->199|1l5aA1|1.3e-43|46.6|174/0|c.43.1.2|1/1|CoA-dependent acyltransferases| HM:SCP:REP 188->450|1l5aA2|3e-46|34.7|248/0|c.43.1.2|1/1|CoA-dependent acyltransferases| HM:SCP:REP 473->548|1dnyA_|1.5e-16|48.7|76/76|a.28.1.2|1/1|ACP-like| OP:NHOMO 1248 OP:NHOMOORG 284 OP:PATTERN -------------------------------------------------------------------- 2---8------211B7633-31--H63333343222C9LL-553---------11--3--EA--H48D5K2------------------------------7---D---1-------------------1--------------U-56A-99B--------------C8N2-------------------1--F112125131132351--446B116---31--------M--11111111111111-11--------------1---------------------22--------------------------------------2----3-----E-22------1-------1-1----------------1---------342-9---25---------------22-22-2-2---1557------2--5-1---1----------------1----------------------------------------------222227E79962224EEEC5A2223-3-----5--4--3---51-------2----------4----------1--------------------P9-----------------------------23---1----------4--------------------------21612-1---2-22--------------------------43AF-----------------1----------111111--11---------1----13B-6---------------22232-1---736636G69824554-A8G-------------2-11112--11--21111----------------------------------------------------------------8- --------------22-3-45568B53------6542----11----238343431A43111---------------------------1----5------------1-13-----------------------------------------------1-------------------------1---12----111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 547 STR:RPRED 99.5 SQ:SECSTR ccccEEccGGGGcHHHHTcEEEEEEEEEEEcccGGGHHHHHHHHHHHHHHHHHHcGGGGcEEEEEcccEEEEEccccccEEEEEEcTTHHTccGGGccHHHHcccccccccTTccTTcccccEEEEEEEEEEEEEEETTTccHHHHHHHHHHHHHHHHTTcHTccccHHHHHHTTcccTTcccccTTccccGccGGTTccccTTccccTccEEEEEEEEcHHHHHHHHHHHHTTccTTcccccHHHHHHHHHHHHHHHHHTTTccTTcEEEEEEEEEcHHHHTccTTcccccEEEEEEHHHHHHccHHHHHHHHHTTccHHHHHHHHHHHHHHHHccccTTccTTTTccTTTcEEEEcTTccGGGccTTccccccEEEcccccccTTEEEEcccTTccEEEEEEEEHHHHHHHHHcHHHHTTcEEcEEEEccccccccHH###HHHHHHHHTTTccccEEEEEETTTTEcccccccccHHHHHHHHHHHHHHTcccccccccTTccccccHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHcHH DISOP:02AL 550-551| PSIPRED ccccccccHHHHHHHHHHHHcccccEEEEEEEEEEcccccHHHHHHHHHHHHHHccHHEEEEEEEccEEEEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHcEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccEEEEEccccccccccEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHcccccccccccHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHc //