[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : pkn1
DDBJ      :pkn1         putative serine/threonine protein kinase
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  421/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:178 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   40->158 2vrxB PDBj 2e-16 34.8 %
:RPS:PDB   36->168 3c5iA PDBj 2e-16 8.3 %
:RPS:SCOP  36->164 1nw1A  d.144.1.8 * 6e-17 14.0 %
:HMM:SCOP  35->176 1vzoA_ d.144.1.7 * 4.7e-35 39.6 %
:RPS:PFM   40->178 PF00069 * Pkinase 4e-17 40.6 %
:HMM:PFM   34->157 PF00069 * Pkinase 1.8e-32 37.4 123/260  
:BLT:SWISS 38->178 PKN2_MYXXA 3e-19 35.5 %
:PROS 70->82|PS00108|PROTEIN_KINASE_ST

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68349.1 GT:GENE pkn1 GT:PRODUCT putative serine/threonine protein kinase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(794749..795285) GB:FROM 794749 GB:TO 795285 GB:DIRECTION - GB:GENE pkn1 GB:PRODUCT putative serine/threonine protein kinase GB:NOTE PF00069: Protein kinase domain, PF07714: Protein tyrosine kinase GB:PROTEIN_ID BAC68349.1 LENGTH 178 SQ:AASEQ MLFTNLDGVRNVVPVGHRQRRARPVGAGDVRAEKSLRYHLQEHGRLPLNEAVAVLSDVAEALADLKDREIVHRDLKPENILLLGGRRCLADFGIARYAEATIAKHTLKLAGTLAYMAPERWNNQRAASASDIYAPGVVAYELLEETPPFTGPYEHDYHDQHLHGPVRPSPQLRPSWRR GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 38->178|PKN2_MYXXA|3e-19|35.5|141/830| PROS 70->82|PS00108|PROTEIN_KINASE_ST|PDOC00100| BL:PDB:NREP 1 BL:PDB:REP 40->158|2vrxB|2e-16|34.8|115/274| RP:PDB:NREP 1 RP:PDB:REP 36->168|3c5iA|2e-16|8.3|132/343| RP:PFM:NREP 1 RP:PFM:REP 40->178|PF00069|4e-17|40.6|138/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 34->157|PF00069|1.8e-32|37.4|123/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 36->164|1nw1A|6e-17|14.0|129/365|d.144.1.8| HM:SCP:REP 35->176|1vzoA_|4.7e-35|39.6|139/322|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 8315 OP:NHOMOORG 625 OP:PATTERN -----------------1-1--1--------------------1---2---------3---1------ 3Ck3O33333333358999-9933G88888879CCCC7PG3XHd43323444457334225562CAELLKE3333344111271------2--1--------------1-1------11111112--------2--666CB---H283583334511------12249746------------54444112111111111111111111111111111111111122222211111111-1111111111111111111211111111111-11111111111111111111111111111111111111111111111111121122111111112111111111113111131111121111211111--1O-R-----------11----1----------------11-1-1-1-1-----211--1----1-2----1-11-----------1----1-----------------------------------------2211111-------22-----11--11---1---531--1112111141111------------164-6131-------------1-----99A9V*-3------------------------1------15----2------1------1-1-11------2--------------------------------------------------------------------------------------------2---------116-1---------------------11--12111211-231-111-------------1----------1------1--111----------1111------------------1--1-----1-------------------31 658BQVN-pRROEHSBB9CFEECBBBB98AB7ABC99EBC9CDC58DBGHDCFD89H9DFGHDAABDB65DDA67EJAGGF8889AAC-GOEBBGIHCFEBEATVa4PcWh******SMMLY*Z**O*R***B***RWOO*Lg*cKlXLL*OG*Py*r*ak*eUWWG*NUtcyYP5*hI*JFFMGt***A**DKknpld ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 99.4 SQ:SECSTR #HHHHcccTTcccEEEEEEcccEEEEEEEcccGHcGGcccHHHHHHHHHHHHHHHHHHTTcccGGGcEEEEcccccGGGEEEccEEEcccTTcEEEEHHHHHHHHHHHGGGEEcccccTTccEEcGGGcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcTTccHHHHH PSIPRED cccEEcccccEEEEEEEEEEccEEEEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEEccEEEEEcccEEEEcccccccccccccccHHHccHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccc //