[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : potD3
DDBJ      :potD3        putative polyamine ABC transporter solute-binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  419/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   92->385 1poy1 PDBj 4e-15 27.4 %
:RPS:PDB   84->402 1a7lA PDBj 2e-30 12.2 %
:RPS:SCOP  84->402 1a7lA  c.94.1.1 * 2e-29 12.5 %
:HMM:SCOP  84->431 1a99A_ c.94.1.1 * 8.6e-58 27.2 %
:RPS:PFM   98->356 PF01547 * SBP_bac_1 5e-08 30.8 %
:HMM:PFM   111->358 PF01547 * SBP_bac_1 8.2e-13 20.1 229/314  
:BLT:SWISS 65->432 YDCS_ECOLI 3e-86 45.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68835.1 GT:GENE potD3 GT:PRODUCT putative polyamine ABC transporter solute-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1411647..1412945 GB:FROM 1411647 GB:TO 1412945 GB:DIRECTION + GB:GENE potD3 GB:PRODUCT putative polyamine ABC transporter solute-binding protein GB:NOTE PF01547: Bacterial extracellular solute-binding protein GB:PROTEIN_ID BAC68835.1 LENGTH 432 SQ:AASEQ MIRGAPTESGIPSPSAPSFHLSPPHPHTVEISLRLHRSFKAAAAAGALLLVSGCGLFTESDASSSAYGLNPPDLKAQSKLGKTEGQVNLIAWAGYVEDGSNDPKADWVSSFEQRTGCQVKSKVAASSDEMVKLMKTGNYDAVSASGDASLRLIASGDAAPVNTDLVPNYQDVFFGLKKQAWNSFDGQPYGIPHGRGANLLMYNTQQVKPAPTSWSAVFDDASPHKGHVTAYDSPIYIADAALYLRETQPGLNIENPYALDQDQFDAAVALLKDQNANVGEYWSDYLKEVSAFKSGDSTVGTTWQVIANLAADEGAKVKAVLPIEGATGWSDTWMISAKAKHPNCAYKWMNWIISPKVNAEVAEYYGEAPSNIKACDEISDDAFCDTYHATDEGYWKDIAFWTTPIEQCLDGRTEVKCVPYAKWVQAWTEIKG GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 65->432|YDCS_ECOLI|3e-86|45.5|354/381| TM:NTM 1 TM:REGION 38->60| SEG 41->50|aaaaagalll| BL:PDB:NREP 1 BL:PDB:REP 92->385|1poy1|4e-15|27.4|274/323| RP:PDB:NREP 1 RP:PDB:REP 84->402|1a7lA|2e-30|12.2|312/380| RP:PFM:NREP 1 RP:PFM:REP 98->356|PF01547|5e-08|30.8|247/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 111->358|PF01547|8.2e-13|20.1|229/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 84->402|1a7lA|2e-29|12.5|312/380|c.94.1.1| HM:SCP:REP 84->431|1a99A_|8.6e-58|27.2|320/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 704 OP:NHOMOORG 425 OP:PATTERN ----------------1-------111-1--------------------------------------- -1--2--------------------1--------------11-1------------------1-1--2--1-----------1--------1--------------------------------------------12211---11--11----2-----------1111----------------------1-11111-111111--1--111-111111--1111111111-11111111111111-111--1-1111-11111111111-11111111111111111111111111111111111111111--111---1--11-1111111111111111111-11----1--1-------------1-----111------------------11111111113--------1371-322122523243-----11-1-1133111111111------11-----------------------------------11111322533111113362222211733-----------------3-311-----312233333--1-1---1---11--1--1--------11-----1-----------------------------321-2-------11-11-1---1--2113--------------23-1-313333333333-333333332333333333333322--1222222222221212222231113-----------------------1111--2-2111222122222222--------1---43535865455562221111111111-222233333232331111-11----------111----------------------------------------1--111-111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 356 STR:RPRED 82.4 SQ:SECSTR ###########################################################################ccEEcccccccEEEEccTTccHHHHHHHHHTHHHHHHHHHcccEEEEccTTHHHHHHHHGGGTccEEEEEGGGHHHHHHTTccccccccHHHHTTccHHHHHHHGGGEETTEEccEEEEEEccEEEEETTTccccccccTTHHHHHHHHHccccccccHHHHHHHHHHTTcEEEccccccEEcccHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHTTcccEEEEcGGGHHHHHHHTccEEEEccccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccHHHHHHHHTcccHHHHHHHHHHHHHHHHH# DISOP:02AL 1-37| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHcccccEEEEccHHHHHHHHccccccccHHHcccHHHccHHHHHHHcccccccEEEEEEEEccEEEEEEHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHHccccccHHHHHcccHHHHHcccccccHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHcc //