[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : prpB3
DDBJ      :prpB3        putative magnesium or manganese-dependent protein phosphatase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  97/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.219.1
:395 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  166->384 1txoA_ d.219.1.1 * 3.5e-06 21.5 %
:RPS:PFM   192->378 PF07228 * SpoIIE 3e-14 35.4 %
:HMM:PFM   193->382 PF07228 * SpoIIE 2.6e-36 28.0 189/193  
:BLT:SWISS 102->323 RSBU_BACSU 5e-13 26.4 %
:PROS 376->391|PS00216|SUGAR_TRANSPORT_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68803.1 GT:GENE prpB3 GT:PRODUCT putative magnesium or manganese-dependent protein phosphatase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1378554..1379741 GB:FROM 1378554 GB:TO 1379741 GB:DIRECTION + GB:GENE prpB3 GB:PRODUCT putative magnesium or manganese-dependent protein phosphatase GB:NOTE PF01590: GAF domain GB:PROTEIN_ID BAC68803.1 LENGTH 395 SQ:AASEQ MNRFVAVERALRTAAPHQLLDALREVLRNRYAAESVEFLLADYGVTVLQPLSPEVSATGPVPLHDSRAGRAFGAQEPFLEEPADGLARVHLPVTVRGDRLGVLTVTLPSEDVKDSLPELREIAEVLGHAVIVAERDTDVYVQARRKDRLTLAAEMQWQLLPGRSCSRPEYALGAQLEPAYAIFGDNFDWSADPDRLMLYITNGMGEGIEASLLTSLGINALRNARRAGIPIEDQAALADQAVYAQYRGTSYLAVLLVEFELSTGRMKVVDAGSPRMLRLRGRSVEAVDFEAQLPLGMFEETDYVAQEFHVEPGDRLVFVSDGVHGVAAPGGETYGEKALTRAITATRLLSAAEVPHAVLRELSGHRGGPSPADDALVVCLDWYGRRGASPAPEGD GT:EXON 1|1-395:0| BL:SWS:NREP 1 BL:SWS:REP 102->323|RSBU_BACSU|5e-13|26.4|220/335| PROS 376->391|PS00216|SUGAR_TRANSPORT_1|PDOC00190| RP:PFM:NREP 1 RP:PFM:REP 192->378|PF07228|3e-14|35.4|181/193|SpoIIE| HM:PFM:NREP 1 HM:PFM:REP 193->382|PF07228|2.6e-36|28.0|189/193|SpoIIE| GO:PFM:NREP 1 GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| HM:SCP:REP 166->384|1txoA_|3.5e-06|21.5|195/0|d.219.1.1|1/1|PP2C-like| OP:NHOMO 169 OP:NHOMOORG 101 OP:PATTERN -------------------------------------------21-12-------------------- 284-1----------------------------1111-1--1-13----11-111---------1--344----------1-1-----11--------------------------------------1---2---64423---3-1-11-1-----111111----------1------1------------1-------------------11-------------------------------------------------------------------------------------------------------------------------------------------1---2-22---------1-------------------------1------------------------------1---1--1-------1------------------2----------------------------------1------------------------------------------------------------------------1131-1----1111112512213-2-----213----------------------------------------------1--------1----1---------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------1-1-------------442211------------------------------------1--1--1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 384-395| PSIPRED cccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccEEEEEccccEEEEEcccccccccccccccccccHHHcccccEEEEccccccEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEHHHcccEEEEEEEcccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccEEEEEEcccccEEEEcccEEEEEEcccccEEEcccccccEEEEEEEccccEEEEEccccEEccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccccccccc //