[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : prpE1
DDBJ      :prpE1        putative magnesium or manganese-dependent protein phosphatase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  207/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.2d.122.1d.219.1
:660 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   97->287 3dbaA PDBj 3e-08 12.5 %
:RPS:PDB   453->587 1a6qA PDBj 3e-08 15.6 %
:RPS:SCOP  239->292 1mc0A2  d.110.2.1 * 4e-07 18.5 %
:RPS:SCOP  577->615 1bknA2  d.122.1.2 * 3e-05 17.9 %
:HMM:SCOP  116->300 1mc0A2 d.110.2.1 * 1.4e-05 27.8 %
:HMM:SCOP  317->533 1txoA_ d.219.1.1 * 2e-06 20.1 %
:HMM:SCOP  555->654 1s16A2 d.122.1.2 * 8.7e-05 29.6 %
:RPS:PFM   344->530 PF07228 * SpoIIE 3e-12 33.7 %
:HMM:PFM   343->531 PF07228 * SpoIIE 3.5e-53 41.6 185/193  
:HMM:PFM   575->654 PF02518 * HATPase_c 8.8e-09 30.0 80/111  
:HMM:PFM   240->281 PF06018 * CodY 9.1e-05 35.0 40/177  
:BLT:SWISS 302->528 ICFG_SYNY3 1e-13 27.4 %
:BLT:SWISS 576->651 LVHK2_ERYLH 8e-04 43.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69265.1 GT:GENE prpE1 GT:PRODUCT putative magnesium or manganese-dependent protein phosphatase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1913338..1915320 GB:FROM 1913338 GB:TO 1915320 GB:DIRECTION + GB:GENE prpE1 GB:PRODUCT putative magnesium or manganese-dependent protein phosphatase GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC69265.1 LENGTH 660 SQ:AASEQ MTEHHTPHEGPAQASRQSGGPLSGAGPVAPVTPMGPRVTRTPQPPPAHGRHDGGRPGQPGKGPVTPSRADTGRHAPEGDAPEAEYAEGAVPDSTGPQTDRLRYLDVATRQIARGMDLDETLRELHRAAVPAFADVIFIHLHDPLPVGDEKSAAPVALQLHSIDRTPEPAHTGWSRMPAPTSLPLPSDVAERVHLTATGRLATLLLAGRPAFGDAPGIAPAVAELLGPVASVPGALPPGRRLVIAPLHGRHHVMGTVVLLRRPDRPAFTGDDLLVASQLATHTALGVQKAVMYGHEASVADTLQHTMLPSSLPEPTGVRLASRYLPASKTAQVGGDWYDAIPLPGSRVALIVGDVMGHSMTSAAIMGQLRTSVQTLAGLDLPPDEVLHHLDEQAQRLGSDHIATCLYAIYDPISHRLLMASAGHPPAVLLHPDGRGEVLRIPPGAPIGVGGVAFESVEMPAPTGATLLLYTDGLVESRETDVGTGVEALRARLQATADGRAAPSLERLCDQVLGTLGPGTRDDDIALLAARFEGFPPDSVGYWFLAPHPLTARQARRLTRRTLRRWGLESLLDSTELMVSEVVTNAVRFASRPIALRLLRTDVLRCEVTDDSPQVPRMRHAEPGDEGGRGLFLVNQLARRWGATRLSTGKVVWFEQLIPKK GT:EXON 1|1-660:0| BL:SWS:NREP 2 BL:SWS:REP 302->528|ICFG_SYNY3|1e-13|27.4|223/634| BL:SWS:REP 576->651|LVHK2_ERYLH|8e-04|43.2|74/100| SEG 194->208|ltatgrlatlllagr| SEG 440->452|ippgapigvggva| SEG 549->564|ltarqarrltrrtlrr| RP:PDB:NREP 2 RP:PDB:REP 97->287|3dbaA|3e-08|12.5|168/171| RP:PDB:REP 453->587|1a6qA|3e-08|15.6|128/363| RP:PFM:NREP 1 RP:PFM:REP 344->530|PF07228|3e-12|33.7|187/193|SpoIIE| HM:PFM:NREP 3 HM:PFM:REP 343->531|PF07228|3.5e-53|41.6|185/193|SpoIIE| HM:PFM:REP 575->654|PF02518|8.8e-09|30.0|80/111|HATPase_c| HM:PFM:REP 240->281|PF06018|9.1e-05|35.0|40/177|CodY| GO:PFM:NREP 1 GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| RP:SCP:NREP 2 RP:SCP:REP 239->292|1mc0A2|4e-07|18.5|54/154|d.110.2.1| RP:SCP:REP 577->615|1bknA2|3e-05|17.9|39/172|d.122.1.2| HM:SCP:REP 116->300|1mc0A2|1.4e-05|27.8|151/0|d.110.2.1|1/1|GAF domain-like| HM:SCP:REP 317->533|1txoA_|2e-06|20.1|194/0|d.219.1.1|1/1|PP2C-like| HM:SCP:REP 555->654|1s16A2|8.7e-05|29.6|98/213|d.122.1.2|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 613 OP:NHOMOORG 211 OP:PATTERN -------------------------------------------21-12-------------------- 276-H--1-------3311-17--4111111146662---2DCDS3--111---------11--A31icUA-------1-1-3-----11----------------1-1-----------1111----------2-77732---5-21132212211111111232134231111111111-1----------1------1------1--11112---132--11------2-11111111111111111111--------------------------------------------------------------------------------------1--------11----1---1-11---1-----1----------------1--------2------------------------------------11-----1--------------------4----------------------------------1---111-----------------------------------------1------------------------1-A412122-82221-4632625-2-----433---------------------------------------------1------1-------3-1-------------------------------------------------------------------------------------------------------2-----------------------------1---------------111----------1---------------11111111-------1895554--------2--------------------------------11111-31 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 47.9 SQ:SECSTR ################################################################################################HHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHEEEEEEEEEEEETTEEEEEEEcccTTcEEEEcTTccHHHHcccGGGccEEcTTccHHHHH###########HHHTccHHHTccEEEccGGGcTTcccHHHHHHccccccEEEEEEETTEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHTcHHHHHHcc#############################################################################################################################################################EEEEEccTTTEEEEEEEcHHHHTTccHH##HHHHHHHHHHTTcccHHHH##HHHHHHHHHH###TTccccEEEEEETcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHccTTTGGGGGHHHHHHHHHHHcc######################################################################### DISOP:02AL 1-4, 8-9, 621-623| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEccHHHcccccccccccHHHcHHHccHHHHHHHcccccccccccccccccccccccccccHHHHHHcccccEEccccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcccccccccEEEEEEEEcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEEEEccccEEEEEEccccccEEEcccccEEEEEcccccEEcccccccccEEEEEccccEEEEEEcccEEcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHEEccccEEEEEEEccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEEcccc //