[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : prpI1
DDBJ      :prpI1        putative magnesium or manganese-dependent protein phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1d.219.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   125->251 1a6qA PDBj 5e-11 14.6 %
:RPS:PDB   240->323 3cwvA PDBj 2e-05 14.3 %
:RPS:SCOP  238->304 1gjvA2  d.122.1.4 * 2e-04 31.3 %
:HMM:SCOP  7->196 1txoA_ d.219.1.1 * 9.6e-07 25.3 %
:HMM:SCOP  211->323 1kijA2 d.122.1.2 * 6.4e-07 25.2 %
:RPS:PFM   1->193 PF07228 * SpoIIE 2e-11 36.0 %
:HMM:PFM   1->194 PF07228 * SpoIIE 1.5e-51 42.5 179/193  
:HMM:PFM   239->317 PF02518 * HATPase_c 2.8e-10 36.7 79/111  
:BLT:SWISS 54->279 Y1364_MYCTU 1e-07 25.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68278.1 GT:GENE prpI1 GT:PRODUCT putative magnesium or manganese-dependent protein phosphatase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 719128..720147 GB:FROM 719128 GB:TO 720147 GB:DIRECTION + GB:GENE prpI1 GB:PRODUCT putative magnesium or manganese-dependent protein phosphatase GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC68278.1 LENGTH 339 SQ:AASEQ MVGDVVGHGIHAAATMGRLRTAVRTLADIDLPPDELLTHLDDVVIRLSAEVSSEASAQTDTESAGDIGATCLYAVYDPVAGRCTLARAGHVLPVVMARDGIADILELPAGPPLGLGGLPFEAAEIDLPEGSLIALYTDGLVEALDHDIEAGLTRLCHALAQPSASLEATCDTALDALLPAGRPHDDVALLLARTHTLGERQVVTWDVDADPAEVARARAHVSEQLTTWGLEELDFTTELVVSELVTNAIRYGRPPIQLRLIHDRTLMCEVADAGSTTPHLRRARVFDEGGRGLFLVAQLAEHWGTRHARRGKTVWAECALGAPELFSTGLDLEGIPGVV GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 54->279|Y1364_MYCTU|1e-07|25.1|223/653| SEG 105->124|lelpagpplglgglpfeaae| RP:PDB:NREP 2 RP:PDB:REP 125->251|1a6qA|5e-11|14.6|123/363| RP:PDB:REP 240->323|3cwvA|2e-05|14.3|84/349| RP:PFM:NREP 1 RP:PFM:REP 1->193|PF07228|2e-11|36.0|178/193|SpoIIE| HM:PFM:NREP 2 HM:PFM:REP 1->194|PF07228|1.5e-51|42.5|179/193|SpoIIE| HM:PFM:REP 239->317|PF02518|2.8e-10|36.7|79/111|HATPase_c| GO:PFM:NREP 1 GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| RP:SCP:NREP 1 RP:SCP:REP 238->304|1gjvA2|2e-04|31.3|67/165|d.122.1.4| HM:SCP:REP 7->196|1txoA_|9.6e-07|25.3|174/0|d.219.1.1|1/1|PP2C-like| HM:SCP:REP 211->323|1kijA2|6.4e-07|25.2|111/212|d.122.1.2|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 165 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----F----------21----3--2-------1222-----49893--1-------------1-72-bRJ6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 57.5 SQ:SECSTR ############################################################################################################################ccTTTEEEEEEEcHHHHTTccHHHHH###HHHHHHHTTcccHHHHHHHHHHHHHHTTc#cccEEEEEEEcTTcccccHHHHHHHHHHHHHHHHHHHHHTTcccccTTTGGGGGHHHHHHHHHHHcccHHTTcccEEEEcTTccEEEEEEEccccHHHHHHHHTTTTccHHHHHHTEEEEEEEEEETTEEEEEEEETTEE################ DISOP:02AL 278-287| PSIPRED cEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEccccEEEEEEccccccEEEccccEEEEEEcccccEEccccccccEEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccEEEEEEEccccccccEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHccEEEccccEEEEEEEEcccccccccccccccccEEc //