[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : pteE
DDBJ      :pteE         ferredoxin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->63 1rofA PDBj 1e-05 33.3 %
:RPS:SCOP  2->64 1iqzA  d.58.1.4 * 3e-07 19.0 %
:HMM:SCOP  1->64 1sj1A_ d.58.1.4 * 7e-09 28.1 %
:RPS:PFM   1->63 PF06902 * DUF1271 1e-05 40.3 %
:HMM:PFM   1->63 PF06902 * DUF1271 1.3e-12 25.9 58/64  
:BLT:SWISS 1->64 FERS_STRGR 7e-15 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68121.1 GT:GENE pteE GT:PRODUCT ferredoxin GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(494248..494442) GB:FROM 494248 GB:TO 494442 GB:DIRECTION - GB:GENE pteE GB:PRODUCT ferredoxin GB:NOTE fdxI, filipin gene cluster, PF00037: 4Fe-4S binding domain GB:PROTEIN_ID BAC68121.1 LENGTH 64 SQ:AASEQ MRITIDRDRCIGSGQCAMTAPGVFTQDDDALVALVPGHEDGAGDPRVHDVPMACPVQAVAIFED GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 1->64|FERS_STRGR|7e-15|50.0|64/65| BL:PDB:NREP 1 BL:PDB:REP 1->63|1rofA|1e-05|33.3|60/60| RP:PFM:NREP 1 RP:PFM:REP 1->63|PF06902|1e-05|40.3|62/63|DUF1271| HM:PFM:NREP 1 HM:PFM:REP 1->63|PF06902|1.3e-12|25.9|58/64|DUF1271| RP:SCP:NREP 1 RP:SCP:REP 2->64|1iqzA|3e-07|19.0|63/81|d.58.1.4| HM:SCP:REP 1->64|1sj1A_|7e-09|28.1|64/66|d.58.1.4|1/1|4Fe-4S ferredoxins| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 98.4 SQ:SECSTR cccEEcTTTcccccccTTTcTTTcccccccccccccccccccccTTHHHHHHHcTTccEEccc# DISOP:02AL 64-65| PSIPRED cEEEEEHHHcHHHcHHHHHcccccEEcccccEEEEcccccccHHHHHHHHHHHcccccEEEEEc //