[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : pteF
DDBJ      :pteF         putative LuxR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.248.1a.4.6d.110.3
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   142->203 3cloC PDBj 2e-05 35.5 %
:RPS:PDB   41->100 3c2wD PDBj 6e-05 6.7 %
:RPS:PDB   151->216 3cloA PDBj 2e-12 31.8 %
:RPS:SCOP  35->99 2fi0A1  a.248.1.1 * 2e-06 10.8 %
:RPS:SCOP  157->217 1a04A1  a.4.6.2 * 3e-09 26.2 %
:HMM:SCOP  36->96 1g28A_ d.110.3.6 * 7.5e-05 24.6 %
:HMM:SCOP  135->221 1p4wA_ a.4.6.2 * 1.4e-10 27.6 %
:RPS:PFM   157->211 PF00196 * GerE 2e-04 36.4 %
:HMM:PFM   156->210 PF00196 * GerE 6e-11 32.7 55/58  
:HMM:PFM   40->127 PF08448 * PAS_4 3.8e-09 21.8 87/110  
:BLT:SWISS 79->136 QUEF_LEPIN 5e-04 51.1 %
:BLT:SWISS 157->206 NARP_HAEIN 2e-05 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68119.1 GT:GENE pteF GT:PRODUCT putative LuxR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(489621..490319) GB:FROM 489621 GB:TO 490319 GB:DIRECTION - GB:GENE pteF GB:PRODUCT putative LuxR-family transcriptional regulator GB:NOTE filipin gene cluster, PF00196: Bacterial regulatory proteins, luxR family GB:PROTEIN_ID BAC68119.1 LENGTH 232 SQ:AASEQ MTPLLTAFTAAHRPPNLFRPSFLTGGTLLLIPAPATPGLCMASLDKTLTIQQANQEFFRQFNGSSEDICGRNFRDVVHPSVQQPLVRQFSNLLEGKNHRFVTPVIAVGPGEESAFTVPLTAVAVRGGLPDTTAILVMMPTAGDAEQTRVVPKRKKILSTMDARILEGIAAGVSTVPLAASLYLSRQGVEYHVTCLLRKLKVSNRAALVSRAYSLGVFKVGTWPPEVVDDFVK GT:EXON 1|1-232:0| BL:SWS:NREP 2 BL:SWS:REP 79->136|QUEF_LEPIN|5e-04|51.1|45/133| BL:SWS:REP 157->206|NARP_HAEIN|2e-05|40.0|50/208| BL:PDB:NREP 1 BL:PDB:REP 142->203|3cloC|2e-05|35.5|62/248| RP:PDB:NREP 2 RP:PDB:REP 41->100|3c2wD|6e-05|6.7|60/478| RP:PDB:REP 151->216|3cloA|2e-12|31.8|66/249| RP:PFM:NREP 1 RP:PFM:REP 157->211|PF00196|2e-04|36.4|55/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 156->210|PF00196|6e-11|32.7|55/58|GerE| HM:PFM:REP 40->127|PF08448|3.8e-09|21.8|87/110|PAS_4| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 35->99|2fi0A1|2e-06|10.8|65/79|a.248.1.1| RP:SCP:REP 157->217|1a04A1|3e-09|26.2|61/67|a.4.6.2| HM:SCP:REP 36->96|1g28A_|7.5e-05|24.6|61/0|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| HM:SCP:REP 135->221|1p4wA_|1.4e-10|27.6|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 72.4 SQ:SECSTR ##################################HcccEEEEEEcTTccEEEEEccHHHHccccccTTccccHHHHcHHHHHHHHHHHHcccccEEEEEEEEEEEcTTHccH##EEEEEEEEEEEET##############TEEEEcccHHHHTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHTccTc############## DISOP:02AL 139-155| PSIPRED cccHHHHHHHHcccccccccccccccEEEEEEccccccEEEEEccHHHHHHHccHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHcc //