[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : pucE
DDBJ      :pucE         putative xanthine dehydrogenase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  386/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.15.4
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->166 1t3qA PDBj 1e-33 49.3 %
:RPS:PDB   6->167 3b9jA PDBj 7e-46 40.3 %
:RPS:SCOP  9->84 1dgjA2  d.15.4.2 * 8e-23 44.7 %
:RPS:SCOP  88->166 1ffuA1  a.56.1.1 * 8e-20 49.2 %
:HMM:SCOP  6->84 1n62A2 d.15.4.2 * 2.2e-26 55.7 %
:HMM:SCOP  79->179 1dgjA1 a.56.1.1 * 1.2e-29 53.2 %
:RPS:PFM   79->166 PF01799 * Fer2_2 3e-16 60.0 %
:HMM:PFM   79->170 PF01799 * Fer2_2 1.3e-33 59.5 74/75  
:HMM:PFM   12->59 PF00111 * Fer2 4.5e-12 38.3 47/77  
:BLT:SWISS 9->166 YAGT_ECO57 1e-53 63.2 %
:PROS 106->117|PS00070|ALDEHYDE_DEHYDR_CYS
:PROS 45->53|PS00197|2FE2S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69251.1 GT:GENE pucE GT:PRODUCT putative xanthine dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1883628..1884200) GB:FROM 1883628 GB:TO 1884200 GB:DIRECTION - GB:GENE pucE GB:PRODUCT putative xanthine dehydrogenase GB:NOTE PF01799: [2Fe-2S] binding domain GB:PROTEIN_ID BAC69251.1 LENGTH 190 SQ:AASEQ MAPSTSSAITLNINGEKHTLPVDHRTTLLDALRERLDLTGTKKGCDQGQCGACTVLLDGRRAVSCLQLAVAAEGRVITTIEGVADGEQLHPVQQAFLDLDGYQCGYCTPGQICSAIAVIEEHAAGWPSAVTADVRPEAGAPPLTADEIRERMSGNLCRCGAYVSIVQAVARAAEAHAADAQAAEVKGAAA GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 9->166|YAGT_ECO57|1e-53|63.2|155/229| PROS 106->117|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| PROS 45->53|PS00197|2FE2S_FER_1|PDOC00175| SEG 168->183|avaraaeahaadaqaa| BL:PDB:NREP 1 BL:PDB:REP 9->166|1t3qA|1e-33|49.3|140/162| RP:PDB:NREP 1 RP:PDB:REP 6->167|3b9jA|7e-46|40.3|144/162| RP:PFM:NREP 1 RP:PFM:REP 79->166|PF01799|3e-16|60.0|70/75|Fer2_2| HM:PFM:NREP 2 HM:PFM:REP 79->170|PF01799|1.3e-33|59.5|74/75|Fer2_2| HM:PFM:REP 12->59|PF00111|4.5e-12|38.3|47/77|Fer2| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| RP:SCP:NREP 2 RP:SCP:REP 9->84|1dgjA2|8e-23|44.7|76/80|d.15.4.2| RP:SCP:REP 88->166|1ffuA1|8e-20|49.2|61/76|a.56.1.1| HM:SCP:REP 6->84|1n62A2|2.2e-26|55.7|79/79|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 79->179|1dgjA1|1.2e-29|53.2|77/113|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| OP:NHOMO 1633 OP:NHOMOORG 543 OP:PATTERN 113-1-2322223323--21111-2---1--------------------------------1------ 13A14---------1--11-12--5711111333331369221211---11-2121----1-A-3495541-------1---3---1--------------1-245-5----------------------------22211----5-1-111---------------1-2--------------12-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------53-24444344434-4------31-21-112-311332-213-------4--4232-----24FGH41337495111111111-1-A9E88CAD562-52241184318C7523-66144445564444444463331421------------------------------2351-45445ABBBBA22221BBCC22221285GCAC4-2665433118251A2131-1111-----------2211-3-4111121111--1113111311-133-4-------------------------111--4112-4-112222231111111--1-1----1---------1--1--2221211-21-2222111212211221221------------------------51--1111-----------------------------321---------------1111111-214166663284464553433---------1---2----------1122222----------2--------------1----------------------------2222------3- ----111-----11-21222121121211232211111111111212211112111-11111-----------1-----------------11-------1-1----262B23223822-22426D151352-32412114225--2-11B-192312226D277236AC7B345-11-7---1133472621-2-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 87.4 SQ:SECSTR #ccHccccEEEEETTEEEEETccTTccHHHHHHHTccccccccccccccccTTEEEEEEEcTTTTTccGGGcTTcEEEcGGGTcTTccccHHHHHHHHTTcccccTTHHHHHHHHHHHHHHcTcccccccHHHHHHHHHHccccHHHHHHHTTTccccccccHHHHH####################### DISOP:02AL 1-5, 8-9, 175-190| PSIPRED cccccccEEEEEEccEEEEEEccccccHHHHHHHHccccccccccccccccEEEEEEccEEHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccc //