[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : rpmE1
DDBJ      :rpmE1        putative ribosomal protein L31
Swiss-Prot:R31B1_STRAW  RecName: Full=50S ribosomal protein L31 type B 1;

Homologs  Archaea  0/68 : Bacteria  408/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->78 2hgu3 PDBj 2e-09 56.8 %
:RPS:PDB   2->78 3bbo1 PDBj 2e-14 20.6 %
:RPS:SCOP  1->78 1vs6Z1  d.325.1.2 * 1e-18 34.4 %
:HMM:SCOP  1->84 1vs6Z1 d.325.1.2 * 2.4e-17 38.6 %
:RPS:PFM   1->78 PF01197 * Ribosomal_L31 8e-15 51.5 %
:HMM:PFM   1->80 PF01197 * Ribosomal_L31 1.8e-27 48.5 68/69  
:BLT:SWISS 1->78 R31B1_STRAW 4e-43 100.0 %
:PROS 49->70|PS01143|RIBOSOMAL_L31
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69283.1 GT:GENE rpmE1 GT:PRODUCT putative ribosomal protein L31 GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1936716..1936991 GB:FROM 1936716 GB:TO 1936991 GB:DIRECTION + GB:GENE rpmE1 GB:PRODUCT putative ribosomal protein L31 GB:NOTE PF01197: Ribosomal protein L31 GB:PROTEIN_ID BAC69283.1 LENGTH 91 SQ:AASEQ MQQDKQPDYHPVVFRDRAAGYAFLTRSTATSDKTIEWDDGETYPVVDVEISSESHPFYTGKARTVDSEGRIAQFERRYGSTGPGSDGGGAA GT:EXON 1|1-91:0| SW:ID R31B1_STRAW SW:DE RecName: Full=50S ribosomal protein L31 type B 1; SW:GN Name=rpmE2-1; OrderedLocusNames=SAV_1572; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->78|R31B1_STRAW|4e-43|100.0|78/91| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 49->70|PS01143|RIBOSOMAL_L31|PDOC00880| SEG 79->89|gstgpgsdggg| BL:PDB:NREP 1 BL:PDB:REP 42->78|2hgu3|2e-09|56.8|37/71| RP:PDB:NREP 1 RP:PDB:REP 2->78|3bbo1|2e-14|20.6|63/72| RP:PFM:NREP 1 RP:PFM:REP 1->78|PF01197|8e-15|51.5|66/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->80|PF01197|1.8e-27|48.5|68/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->78|1vs6Z1|1e-18|34.4|64/70|d.325.1.2| HM:SCP:REP 1->84|1vs6Z1|2.4e-17|38.6|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 424 OP:NHOMOORG 411 OP:PATTERN -------------------------------------------------------------------- ----11111111111-1-------11-----11---1111------11-1111111111111-1111222-1222211----1-----111111111--111111111-111111111111111----------1----------------------------------------------------------111111111111111-1111111-1----111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111--111--1111111------1----------------------------------------------------------11------------------------------1-11-------11-1-111231111111-211111211121111-11-11111111111111111111111111--------1111111-1111------------------111-1-1----1--11111111111--111111-1-----11-1---------11---111111111111111111111111----------11111111--1-------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 85.7 SQ:SECSTR ccTTTcccccHHHHHcccccccccccccccccccTTTccccccccccccccccccccccccccccccccccccccccc############# DISOP:02AL 76-91| PSIPRED ccccccccEEEEEEEEcccccEEEEEEEEccccEEEEEEcccccEEEEEEccccccEEcccEEEEEcccHHHHHHHHHccccccccccccc //