[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : rpoA2
DDBJ      :rpoA2        putative RNA polymerase alpha subunit
Swiss-Prot:RPOA2_STRAW  RecName: Full=DNA-directed RNA polymerase subunit alpha;         Short=RNAP subunit alpha;         EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha;AltName: Full=RNA polymerase subunit alpha;

Homologs  Archaea  0/68 : Bacteria  911/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
a.60.3d.181.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->217 1ynjB PDBj 5e-51 50.5 %
:BLT:PDB   247->309 1z3eB PDBj 1e-17 58.7 %
:RPS:PDB   12->225 1bdfD PDBj 5e-67 45.1 %
:RPS:PDB   246->310 1doqA PDBj 1e-21 40.0 %
:RPS:SCOP  48->169 1bdfA2  d.181.1.1 * 3e-43 43.3 %
:RPS:SCOP  246->310 1doqA  a.60.3.1 * 4e-22 40.0 %
:HMM:SCOP  48->169 1i6vA2 d.181.1.1 * 3.3e-45 53.7 %
:HMM:SCOP  243->323 1cooA_ a.60.3.1 * 1.4e-22 45.7 %
:RPS:PFM   23->217 PF01193 * RNA_pol_L 1e-34 45.9 %
:RPS:PFM   247->301 PF03118 * RNA_pol_A_CTD 4e-18 63.6 %
:HMM:PFM   246->302 PF03118 * RNA_pol_A_CTD 7.2e-29 59.6 57/67  
:HMM:PFM   58->149 PF01000 * RNA_pol_A_bac 2.8e-26 39.6 91/111  
:BLT:SWISS 1->338 RPOA2_STRAW 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68150.1 GT:GENE rpoA2 GT:PRODUCT putative RNA polymerase alpha subunit GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 594232..595248 GB:FROM 594232 GB:TO 595248 GB:DIRECTION + GB:GENE rpoA2 GB:PRODUCT putative RNA polymerase alpha subunit GB:NOTE second RNA polymerase alpha subunit, PF01000: RNA polymerase Rpb3/RpoA insert domain GB:PROTEIN_ID BAC68150.1 LENGTH 338 SQ:AASEQ MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRVDGVLHEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGLVTAADIAPPAGVEVHNPDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLARELNIDAEGIDMGPSPVDAALAADLVMPIEELELTVRSYNCLKREGVHSVGELVARSEADLLDIRNFGAKSIDEVKAKLAGMGLGLKDSPPGFDPTAAALGADDDADAGFLETEHY GT:EXON 1|1-338:0| SW:ID RPOA2_STRAW SW:DE RecName: Full=DNA-directed RNA polymerase subunit alpha; Short=RNAP subunit alpha; EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha;AltName: Full=RNA polymerase subunit alpha; SW:GN Name=rpoA2; OrderedLocusNames=SAV_440; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|RPOA2_STRAW|0.0|100.0|338/338| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 319->331|aaalgadddadag| BL:PDB:NREP 2 BL:PDB:REP 7->217|1ynjB|5e-51|50.5|210/225| BL:PDB:REP 247->309|1z3eB|1e-17|58.7|63/67| RP:PDB:NREP 2 RP:PDB:REP 12->225|1bdfD|5e-67|45.1|213/231| RP:PDB:REP 246->310|1doqA|1e-21|40.0|65/69| RP:PFM:NREP 2 RP:PFM:REP 23->217|PF01193|1e-34|45.9|194/207|RNA_pol_L| RP:PFM:REP 247->301|PF03118|4e-18|63.6|55/67|RNA_pol_A_CTD| HM:PFM:NREP 2 HM:PFM:REP 246->302|PF03118|7.2e-29|59.6|57/67|RNA_pol_A_CTD| HM:PFM:REP 58->149|PF01000|2.8e-26|39.6|91/111|RNA_pol_A_bac| GO:PFM:NREP 6 GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01193|IPR011261| GO:PFM GO:0006350|"GO:transcription"|PF01193|IPR011261| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF01193|IPR011261| GO:PFM GO:0003677|"GO:DNA binding"|PF03118|IPR011260| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF03118|IPR011260| GO:PFM GO:0006350|"GO:transcription"|PF03118|IPR011260| RP:SCP:NREP 2 RP:SCP:REP 48->169|1bdfA2|3e-43|43.3|120/121|d.181.1.1| RP:SCP:REP 246->310|1doqA|4e-22|40.0|65/69|a.60.3.1| HM:SCP:REP 48->169|1i6vA2|3.3e-45|53.7|121/0|d.181.1.1|1/1|Insert subdomain of RNA polymerase alpha subunit| HM:SCP:REP 243->323|1cooA_|1.4e-22|45.7|81/0|a.60.3.1|1/1|C-terminal domain of RNA polymerase alpha subunit| OP:NHOMO 944 OP:NHOMOORG 923 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222221111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22------2-----1-----------------------------------------------------------------------------------------------------------------------------------------------1----------------1-1------1211---1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 92.6 SQ:SECSTR ####cccEEEEEEccccEEEEEEEEEcTTHHHHHHHHHHHHHTTccccEEEEEEEETTccccccccTTccccHHHHHHHHHTccEEEccccEEEEEEEEEccEEEEGGGccccccEEEccTTcEEEEEccTTEEEEEEEEEEcccEEccccccccccccccEEccEEcccEEEEEEEccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHGGGGccccHHTTTTcccGEEEEEEEEccccccHHHHTccHHHHHHHHHTTcccHHHHHHccHHHHTTcTTccHHHHHHHHHHHHHHccccccccccccc##################### DISOP:02AL 228-245, 334-338| PSIPRED cccEEccEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEccEEEEccccccccccHHHHHHHcccEEEEEccccEEEEEEEEEccEEEEEHHEEcccccEEEcccEEEEEEccccEEEEEEEEEEcccEEEccccccccccccEEEEccccccccccEEEEEEEcccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHcccHHHHHHHHHcccEEHHHHHHccHHHHHHccccccccHHHHHHHHHHccccccccccccccHHcccccccccccccEEcccc //