[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : rsbR
DDBJ      :rsbR         putative positive regulatory protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   198->264 2vy9A PDBj 2e-06 33.3 %
:RPS:PDB   178->280 1auzA PDBj 3e-10 17.6 %
:RPS:SCOP  169->277 1h4xA  c.13.2.1 * 8e-15 13.1 %
:HMM:SCOP  166->276 1vc1A_ c.13.2.1 * 8.2e-19 29.1 %
:RPS:PFM   178->261 PF01740 * STAS 2e-10 40.5 %
:HMM:PFM   178->263 PF01740 * STAS 4.3e-11 26.7 86/117  
:BLT:SWISS 168->289 RSBRA_BACSU 8e-28 44.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68804.1 GT:GENE rsbR GT:PRODUCT putative positive regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1379931..1380830 GB:FROM 1379931 GB:TO 1380830 GB:DIRECTION + GB:GENE rsbR GB:PRODUCT putative positive regulatory protein GB:NOTE PF01740: STAS domain GB:PROTEIN_ID BAC68804.1 LENGTH 299 SQ:AASEQ MTDQEPVAHHEAPTQALGDFLRRRREQIAQRWADEALFRTVFTVSRDEAVEAAGAVVEALAAVAFSERIENLGATGFAAVREQLGRMAAARSRAGASADQIADDVSALRPSITELLNADLSEAPDEDARELLITLTVLLGTLRLVVLETVLTAGEELIERQRLQLLEVATPVIKLWTGIVAVPLIGTLDSARSQVVMESLLDAVVAQQARFAILDITGVPTVDSLVAQHLMKTVAAARLMGAECIVSGIRPAIAQTIVHLGIDLGTVVTRASLADALGYALHRQGAVIVDQASAGGIQQ GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 168->289|RSBRA_BACSU|8e-28|44.3|122/274| SEG 48->64|eaveaagavvealaava| SEG 85->98|grmaaarsragasa| SEG 131->152|llitltvllgtlrlvvletvlt| SEG 155->167|eelierqrlqlle| BL:PDB:NREP 1 BL:PDB:REP 198->264|2vy9A|2e-06|33.3|66/112| RP:PDB:NREP 1 RP:PDB:REP 178->280|1auzA|3e-10|17.6|102/116| RP:PFM:NREP 1 RP:PFM:REP 178->261|PF01740|2e-10|40.5|84/107|STAS| HM:PFM:NREP 1 HM:PFM:REP 178->263|PF01740|4.3e-11|26.7|86/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 169->277|1h4xA|8e-15|13.1|107/111|c.13.2.1| HM:SCP:REP 166->276|1vc1A_|8.2e-19|29.1|110/110|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 317 OP:NHOMOORG 73 OP:PATTERN -----------------------------2-------------1---1-------------------- -11-2----------11-------1-----------2----1----------------------11-122-------------------------------1---111-1--------------------------JMNOT---d----1-------------------1---------------1-------6---------------323355-------2--111111----------------------------------------------------------------------------------------------------------------------------1---------1--1-----------------------------------------2-1----1-----------------------------2---------------2-----------------------------------------------1------11--------1-1---------1--1------------1----------------------------------------1--*-----------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------------------11--11111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 34.4 SQ:SECSTR #################################################################################################################################################################################TEEEEcccccccTTHHHHHHHHHHHHHccccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGcGGTcccccGGGTGGGT################### DISOP:02AL 1-5, 7-8, 290-299| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccEEEcccccccccc //