[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : rsbS
DDBJ      :rsbS         putative anti-sigma factor antagonist
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->119 2vy9A PDBj 3e-13 35.6 %
:RPS:PDB   11->122 1auzA PDBj 4e-11 21.6 %
:RPS:SCOP  11->122 1th8B  c.13.2.1 * 3e-12 22.5 %
:HMM:SCOP  8->118 1vc1A_ c.13.2.1 * 2.2e-18 33.6 %
:HMM:PFM   19->104 PF01740 * STAS 1.4e-11 23.3 86/117  
:BLT:SWISS 13->122 RSBS_BACSU 3e-12 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68805.1 GT:GENE rsbS GT:PRODUCT putative anti-sigma factor antagonist GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1380827..1381246 GB:FROM 1380827 GB:TO 1381246 GB:DIRECTION + GB:GENE rsbS GB:PRODUCT putative anti-sigma factor antagonist GB:NOTE PF01740: STAS domain GB:PROTEIN_ID BAC68805.1 LENGTH 139 SQ:AASEQ MIGDPLGRPGIHVPVLKLGNVLLVTLQGDLHDHAAEQLQQDIGEAVASSAVTGVVIDVSGVEIVDSFLGRVFAEIAATARLLAAQTIVAGMRPAVAITLVELGLTLPGLRTALDAEQAMRLLTGTPPHLPHVPGRRESA GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 13->122|RSBS_BACSU|3e-12|30.0|110/121| TM:NTM 3 TM:REGION 9->31| TM:REGION 47->69| TM:REGION 82->104| SEG 73->87|aeiaatarllaaqti| BL:PDB:NREP 1 BL:PDB:REP 14->119|2vy9A|3e-13|35.6|104/112| RP:PDB:NREP 1 RP:PDB:REP 11->122|1auzA|4e-11|21.6|111/116| HM:PFM:NREP 1 HM:PFM:REP 19->104|PF01740|1.4e-11|23.3|86/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 11->122|1th8B|3e-12|22.5|111/115|c.13.2.1| HM:SCP:REP 8->118|1vc1A_|2.2e-18|33.6|110/110|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 65 OP:NHOMOORG 63 OP:PATTERN -----------------------------1-------------1------------------------ -11-1----------11-------1-----------1----1----------------------11-111-------------------------------1---111-1--------------------------11111---1------------------------1---------------1-------1---------------111111-------1--111111----------------------------------------------------------------------------------------------------------------------------1---------1--------------------------------------------2-1----1---------------------------------------------1-----------------------------------------------1------11--------1-1---------1--1-----------------------------------------------------1--2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------11111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 80.6 SQ:SECSTR ##########ccccEEEETTEEEEcccccccTTHHHHHHHHHHHHHccccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHcccGGGTcccccGGGTGGGT################# DISOP:02AL 1-6, 124-139| PSIPRED ccccccccccccccEEEEccEEEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccccEEEEccHHHHHHHHccccccccccccccccc //