[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : rsbT
DDBJ      :rsbT         putative anti-sigma factor
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->77 1tilE PDBj 6e-04 32.4 %
:RPS:PDB   23->116 2c2aA PDBj 7e-05 16.0 %
:RPS:SCOP  7->116 1l0oA  d.122.1.3 * 2e-04 23.6 %
:HMM:SCOP  6->118 1l0oA_ d.122.1.3 * 1.4e-11 27.9 %
:HMM:PFM   23->117 PF02518 * HATPase_c 3.6e-11 29.0 93/111  
:BLT:SWISS 2->119 RSBT_BACSU 4e-19 38.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68806.1 GT:GENE rsbT GT:PRODUCT putative anti-sigma factor GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1381294..1381689 GB:FROM 1381294 GB:TO 1381689 GB:DIRECTION + GB:GENE rsbT GB:PRODUCT putative anti-sigma factor GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC68806.1 LENGTH 131 SQ:AASEQ MDLAWVRQHVRQAAAELGFGLVDQTKLVTAASELARNTLIHGGGGQVQCTPLEIGRSRGLRLTFSDEGPGIADIEQALGDGYTSGGGLGLGLGGARRLVHEFSIDSRPGEGTSVTVICWSAGAPHTREETR GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 2->119|RSBT_BACSU|4e-19|38.1|118/133| SEG 78->94|lgdgytsggglglglgg| BL:PDB:NREP 1 BL:PDB:REP 4->77|1tilE|6e-04|32.4|74/140| RP:PDB:NREP 1 RP:PDB:REP 23->116|2c2aA|7e-05|16.0|94/240| HM:PFM:NREP 1 HM:PFM:REP 23->117|PF02518|3.6e-11|29.0|93/111|HATPase_c| RP:SCP:NREP 1 RP:SCP:REP 7->116|1l0oA|2e-04|23.6|110/141|d.122.1.3| HM:SCP:REP 6->118|1l0oA_|1.4e-11|27.9|111/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 84 OP:NHOMOORG 66 OP:PATTERN -----------------------------1-------------1------------------------ -22-1----------11-------1-----------1----1----------------------11-111-------------------------------1---111-1--------------------------22222---2------------------------2---------------2-------1---------------111111------11--1111111-------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------4-2----2-----------------------------1---------------------------------------------------------------2------11--------2-2---------1--1------------1----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--------------------------1--11111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 96.9 SQ:SECSTR ###HEEEEEEcccTTcccEEEEcHHHHHHHHHHHHHHHHHTcTcTTcEEEEEEEEETTEEEEEEEEccccccGGGTTGGGcTTcccccccTHHHHHHHHHEEEEEEETTTEEEEEEEEEccTTTcccccc# DISOP:02AL 79-83, 120-131| PSIPRED ccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEcccccccHHHHHccccccccccccHHHHHHHHccEEEEEEEccccEEEEEEEccccccccccccc //