[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : sig4
DDBJ      :sig4         putative RNA polymerase ECF-subfamily sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.177.1a.4.13
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->191 3dxjF PDBj 1e-05 10.0 %
:RPS:SCOP  27->84 1z77A2  a.121.1.1 * 3e-07 19.0 %
:HMM:SCOP  24->140 1or7A2 a.177.1.1 * 4.5e-21 29.2 %
:HMM:SCOP  139->206 1or7A1 a.4.13.2 * 4.9e-11 42.6 %
:HMM:PFM   151->199 PF08281 * Sigma70_r4_2 5.5e-15 44.9 49/54  
:HMM:PFM   50->119 PF04542 * Sigma70_r2 5.5e-10 29.4 68/71  
:HMM:PFM   87->165 PF06078 * DUF937 0.00016 18.2 66/137  
:BLT:SWISS 28->85 SIGK_MYCUA 3e-04 37.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68237.1 GT:GENE sig4 GT:PRODUCT putative RNA polymerase ECF-subfamily sigma factor GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 671956..672573 GB:FROM 671956 GB:TO 672573 GB:DIRECTION + GB:GENE sig4 GB:PRODUCT putative RNA polymerase ECF-subfamily sigma factor GB:NOTE PF08281: Sigma-70, region 4 GB:PROTEIN_ID BAC68237.1 LENGTH 205 SQ:AASEQ MTGITLAGKPAARLGRLAGVRSVRKAPRELDEERLVRLVARGDRAAFEELYRRTAPWMALRLRRRCADEQIVAEVMQETYLAVWRAAGAFAGSSAGGTAAGWLWTIAARRLVDAFRRRAHHAEPPVAAALPDAAPAAEEEALATAVGGDVGDALRRLAPELRQVLQAMVLDGLSVRETAVLLGLPEGTVKTRARRARIAMREALA GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 28->85|SIGK_MYCUA|3e-04|37.9|58/187| SEG 86->108|aagafagssaggtaagwlwtiaa| SEG 122->146|aeppvaaalpdaapaaeeealatav| SEG 192->204|rarrariamreal| RP:PDB:NREP 1 RP:PDB:REP 31->191|3dxjF|1e-05|10.0|160/349| HM:PFM:NREP 3 HM:PFM:REP 151->199|PF08281|5.5e-15|44.9|49/54|Sigma70_r4_2| HM:PFM:REP 50->119|PF04542|5.5e-10|29.4|68/71|Sigma70_r2| HM:PFM:REP 87->165|PF06078|0.00016|18.2|66/137|DUF937| RP:SCP:NREP 1 RP:SCP:REP 27->84|1z77A2|3e-07|19.0|58/125|a.121.1.1| HM:SCP:REP 24->140|1or7A2|4.5e-21|29.2|113/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 139->206|1or7A1|4.9e-11|42.6|68/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------1--1-121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 78.0 SQ:SECSTR ##############################HHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHH#HHHcccTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGT############## DISOP:02AL 1-4, 6-32| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //