[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : sig7
DDBJ      :sig7         putative RNA polymerase ECF-subfamily sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.1a.4.13
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->179 2q1zA PDBj 2e-07 24.1 %
:RPS:PDB   17->182 3dxjF PDBj 3e-12 7.8 %
:RPS:SCOP  17->78 1iw7F3  a.177.1.1 * 2e-07 8.1 %
:RPS:SCOP  129->180 1k78A1  a.4.1.5 * 6e-07 13.5 %
:HMM:SCOP  13->88 1h3lA_ a.177.1.1 * 3.4e-16 37.3 %
:HMM:SCOP  113->182 1rp3A2 a.4.13.2 * 5.2e-10 40.0 %
:RPS:PFM   128->177 PF08281 * Sigma70_r4_2 1e-04 48.0 %
:HMM:PFM   128->177 PF08281 * Sigma70_r4_2 2.7e-15 44.0 50/54  
:HMM:PFM   24->92 PF04542 * Sigma70_r2 8.8e-15 33.3 69/71  
:HMM:PFM   13->27 PF12108 * SF3a60_bindingd 0.00016 46.7 15/28  
:BLT:SWISS 14->183 SIGK_MYCTU 9e-08 25.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68410.1 GT:GENE sig7 GT:PRODUCT putative RNA polymerase ECF-subfamily sigma factor GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 854938..855585 GB:FROM 854938 GB:TO 855585 GB:DIRECTION + GB:GENE sig7 GB:PRODUCT putative RNA polymerase ECF-subfamily sigma factor GB:NOTE PF04542: Sigma-70 region 2 GB:PROTEIN_ID BAC68410.1 LENGTH 215 SQ:AASEQ MDGAERLRGGPAAAVRDPQLFEEFYRRHVDAVMRFVARRVDDPHTAADLTAEIFLAVLDSVHTYRPHLGSETAWLYGIARNVVSSERRRVAREAERDLRFSGRRLLEADDIVRLEDRLDAESPGRHALAALARLPEGERAVMELVAVDQLTVTEAAAALGIRQVTARVRLHRARKALREEADVKAAKTNPVAAQASSPGAETPDASLLYVTRGEA GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 14->183|SIGK_MYCTU|9e-08|25.6|168/187| SEG 79->96|arnvvsserrrvareaer| BL:PDB:NREP 1 BL:PDB:REP 16->179|2q1zA|2e-07|24.1|158/176| RP:PDB:NREP 1 RP:PDB:REP 17->182|3dxjF|3e-12|7.8|166/349| RP:PFM:NREP 1 RP:PFM:REP 128->177|PF08281|1e-04|48.0|50/54|Sigma70_r4_2| HM:PFM:NREP 3 HM:PFM:REP 128->177|PF08281|2.7e-15|44.0|50/54|Sigma70_r4_2| HM:PFM:REP 24->92|PF04542|8.8e-15|33.3|69/71|Sigma70_r2| HM:PFM:REP 13->27|PF12108|0.00016|46.7|15/28|SF3a60_bindingd| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 17->78|1iw7F3|2e-07|8.1|62/184|a.177.1.1| RP:SCP:REP 129->180|1k78A1|6e-07|13.5|52/63|a.4.1.5| HM:SCP:REP 13->88|1h3lA_|3.4e-16|37.3|75/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 113->182|1rp3A2|5.2e-10|40.0|70/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ----11---------1111-1-1111111111-1111-------1-------121-------1-111211--------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 77.7 SQ:SECSTR ###############cHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHH################################# DISOP:02AL 180-202, 214-215| PSIPRED cccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccHHHHHHHcccc //