[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : sseC
DDBJ      :sseC         putative thiosulfate sulfurtransferase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  363/915 : Eukaryota  101/199 : Viruses  0/175   --->[See Alignment]
c.46.1
:332 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->235 1urhB PDBj 5e-19 35.7 %
:RPS:PDB   28->319 1e0cA PDBj 2e-18 21.9 %
:RPS:SCOP  32->170 1bohA1  c.46.1.2 * 8e-29 37.7 %
:RPS:SCOP  211->320 1okgA2  c.46.1.2 * 8e-06 18.3 %
:HMM:SCOP  29->176 1okgA1 c.46.1.2 * 1.9e-29 37.0 %
:HMM:SCOP  189->322 1uarA2 c.46.1.2 * 6.2e-23 33.1 %
:HMM:PFM   41->165 PF00581 * Rhodanese 1.1e-13 28.2 103/113  
:HMM:PFM   228->310 PF00581 * Rhodanese 3.2e-12 32.1 81/113  
:BLT:SWISS 42->317 THTM_ECOLI 4e-20 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69046.1 GT:GENE sseC GT:PRODUCT putative thiosulfate sulfurtransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1647024..1648022) GB:FROM 1647024 GB:TO 1648022 GB:DIRECTION - GB:GENE sseC GB:PRODUCT putative thiosulfate sulfurtransferase GB:NOTE PF00581: Rhodanese-like domain GB:PROTEIN_ID BAC69046.1 LENGTH 332 SQ:AASEQ MWDTLAQWARYRSSGAASIRRRVSIPAMTDALLSGPLVDDAWLAAHLDDPRLVVLDATALLPSPRHDGDHRSGSGHAQWAERHIPGSRHADLTGDLSDHEAPYHFAVPSPRALADALQRLGVRDGSEVVAYDSGGGIWAARLWWMLRSISVPAAVLDGGWAVWEEGGHPVAHGDETGAVRVSRPLTPVPRPDVWTGIDEVAAISRGERPGTLVCALPPGGFDGSAATRYSRRGHIPGSLSLPGRGLLDATGRLLPRSELARRTGAVLQDAESPVVLYCGGGISAAGTALALTLLGREDISLYDGSLEEWSGDLSRPIRLGHQLGDQRLGDQR GT:EXON 1|1-332:0| BL:SWS:NREP 1 BL:SWS:REP 42->317|THTM_ECOLI|4e-20|33.9|257/281| SEG 236->247|pgslslpgrgll| SEG 279->295|gggisaagtalaltllg| BL:PDB:NREP 1 BL:PDB:REP 42->235|1urhB|5e-19|35.7|168/255| RP:PDB:NREP 1 RP:PDB:REP 28->319|1e0cA|2e-18|21.9|269/270| HM:PFM:NREP 2 HM:PFM:REP 41->165|PF00581|1.1e-13|28.2|103/113|Rhodanese| HM:PFM:REP 228->310|PF00581|3.2e-12|32.1|81/113|Rhodanese| RP:SCP:NREP 2 RP:SCP:REP 32->170|1bohA1|8e-29|37.7|130/149|c.46.1.2| RP:SCP:REP 211->320|1okgA2|8e-06|18.3|110/134|c.46.1.2| HM:SCP:REP 29->176|1okgA1|1.9e-29|37.0|138/156|c.46.1.2|1/2|Rhodanese/Cell cycle control phosphatase| HM:SCP:REP 189->322|1uarA2|6.2e-23|33.1|133/0|c.46.1.2|2/2|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 588 OP:NHOMOORG 466 OP:PATTERN ----------------------------1-------------------------------------1- --1-1--2222-31--111-11--1-11111-1----2111-1-1-1-11--21111---11--21-1--1-----------1------------------1----------------------------------11112----2111-111--11------1-1-1111------------111-----1--1111111111111111111--11111112--------11--------------------------------------------------------------------------------------------------------------------------------------------1--1111-----112241111111111111111111-11111111511-1111111111112211111111111111111111111111111------------------------------1111221111111111-111111111111-1111111111111112--1-1-1-11-1---1-----------111--1---------------------11-1-1-------------------------------11----111------1---------------111-------11111111111111111-11111111111111111111111111111111111111111111111---11-111111111111-------------11111-------------------------1-11111111111111111-------------1111111--1111----1111-------------------------------------------------------------1- --------------11-1-111111111111-11-11211111111-1--1-11----11-1------------------------1--1---11----------1--2-2322212112121243-72GI4-323-212211422211-2--214123----31--------1--1118-1--11232-31--1-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 97.0 SQ:SECSTR ##HHHHHHHTTcTTccccccccccccccGGGTTcccEEcHHHHHTTTTcTTEEEEEcccccTTcccHHEccccHHHHHHHHcccTTcEEccGcGGGccccTTcTTccccHHHHHHHHHHHTccTTcEEEEEcccccHHHHHHHHHHHHTTccEEEETTHHHHHHHTTcccccccccccccccccccccTTcccHHHHHHHTTHccccTTEEEEEcccHHHHTTccccccTcccccTTcEEccGGGGEEGGGTTEEcTTHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHTTcccEEEcccHHHHHTTcTTcccccccccc######## DISOP:02AL 18-19, 318-332| PSIPRED ccccHHHHHHHHHHHHHHHHHccccccccHHccccccccHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHccccEEEEccHHHHcccccccccccccHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHccccEEEEcccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHccccccccccccccccEEEccHHHHcccccccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHccccccEEccccHHHHHccccccEEEccccccccccccc //