[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ssgA5
DDBJ      :ssgA5        putative cell division protein, regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->132 3cm1A PDBj 3e-16 42.5 %
:RPS:PDB   3->134 3cm1B PDBj 1e-32 40.0 %
:RPS:PFM   23->120 PF04686 * SsgA 4e-17 53.7 %
:HMM:PFM   23->121 PF04686 * SsgA 6.7e-35 53.1 96/100  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69398.1 GT:GENE ssgA5 GT:PRODUCT putative cell division protein, regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2065246..2065662 GB:FROM 2065246 GB:TO 2065662 GB:DIRECTION + GB:GENE ssgA5 GB:PRODUCT putative cell division protein, regulatory protein GB:NOTE PF04686: Streptomyces sporulation and cell division protein, SsgA GB:PROTEIN_ID BAC69398.1 LENGTH 138 SQ:AASEQ MSTVIEQPVEARLVAAAPRMPSIPATLHYDRSDPFAIRMTFPAPATLEGVEVCWTFARELLASGMEEPVGHGDVRVRPYGYDRTVLEFHAPEGTAVVHVRSGEIRRFLERTTELVPVGLEHLQIDLDHDLAELMRDAC GT:EXON 1|1-138:0| BL:PDB:NREP 1 BL:PDB:REP 10->132|3cm1A|3e-16|42.5|120/135| RP:PDB:NREP 1 RP:PDB:REP 3->134|3cm1B|1e-32|40.0|115/119| RP:PFM:NREP 1 RP:PFM:REP 23->120|PF04686|4e-17|53.7|95/100|SsgA| HM:PFM:NREP 1 HM:PFM:REP 23->121|PF04686|6.7e-35|53.1|96/100|SsgA| OP:NHOMO 37 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------14321---------------111-2225551---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 97.1 SQ:SECSTR cTcEEEEEEEEEEccEcETccEEEEEEEEETTcTTEEEEEEccccccccEEEEEEEEHHHHHHHHHccEEETTEEEEEEEcccEEEccccEEccccEEEEHHHHHHHHHHHHHHccTTcHHHHHHHHHHHHTcc#### PSIPRED cccEEEEEEEEEEEEcccccccEEEEEEEcccccEEEEEEEccccccccccEEEEEEHHHHHHHccccccccEEEEEEccccEEEEEEEccccEEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHccc //