[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ssuA1
DDBJ      :ssuA1        putative ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  195/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   99->187 1wdnA PDBj 3e-04 38.5 %
:RPS:PDB   39->342 2de3B PDBj 8e-22 14.5 %
:RPS:SCOP  54->248 1h3dA1  c.94.1.1 * 1e-11 18.3 %
:HMM:SCOP  40->319 2czlA1 c.94.1.1 * 1.3e-33 27.9 %
:RPS:PFM   65->256 PF09084 * NMT1 5e-18 34.2 %
:HMM:PFM   48->260 PF09084 * NMT1 1.8e-70 45.2 210/216  
:BLT:SWISS 36->260 THI5_YEAST 2e-16 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69048.1 GT:GENE ssuA1 GT:PRODUCT putative ABC transporter substrate-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1649428..1650465 GB:FROM 1649428 GB:TO 1650465 GB:DIRECTION + GB:GENE ssuA1 GB:PRODUCT putative ABC transporter substrate-binding protein GB:NOTE sulfonate/nitrate/taurine transport system substrate-binding protein, PF09084: NMT1/THI5 like GB:PROTEIN_ID BAC69048.1 LENGTH 345 SQ:AASEQ MRPRTTALLALATAAALTATGCAAQDSTSAATKNGTTQVTLALDWTPNTNHTGIYVAQQKGWFKDAGIDLRIVPYGSTAPETLVANHKADFGISYQEGVTTARSAGQDITSVYAVTQKTNVTVSVRADRDDIKSPKDLDGKTYAGFGAPYEKALLQKVIQEDGGKGDFKQVTLNTSAYAALYAGKADFAMPMPTWEGLEAKLTGKPLKDFQLADHGFPAIYSTLVASSGQYLKQNPEVAKKFLAVVDKGYEYAAGHPGRAADLLIAANKSTLTNTELVKKSETLLAKEYYRAADGTIGTQTAERWQDFADFEFRAGLLTDKNGKKLTKAPDASTYFTDAYLPDTK GT:EXON 1|1-345:0| BL:SWS:NREP 1 BL:SWS:REP 36->260|THI5_YEAST|2e-16|26.3|224/340| SEG 5->20|ttallalataaaltat| BL:PDB:NREP 1 BL:PDB:REP 99->187|1wdnA|3e-04|38.5|78/223| RP:PDB:NREP 1 RP:PDB:REP 39->342|2de3B|8e-22|14.5|289/347| RP:PFM:NREP 1 RP:PFM:REP 65->256|PF09084|5e-18|34.2|190/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 48->260|PF09084|1.8e-70|45.2|210/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 54->248|1h3dA1|1e-11|18.3|180/220|c.94.1.1| HM:SCP:REP 40->319|2czlA1|1.3e-33|27.9|258/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 330 OP:NHOMOORG 245 OP:PATTERN ------------------------------------------------1------------------- -------------------------1----------1212-2---2--------1-----11-----2-1-11111111--12-------------------------1------1--1-1111------------32212---31------------------------------------------------222222222222222-1----222---1---------151--------------------------------------1-------------1--11111111111-------------1------------12-----------1------1-1-------11-1-----------11--1-----------1-1--2---2-11111111112-22-12-2-121-2222221422114----2222222222---------------1----------------------------------111-1--------------1---------1---------------1-------------------------1122-2121--1----111-----1----1211--------------------21-----11-------12---------------------1------------1-----------------------------------11---------------------1------------------------------1111---12111----1111---1---------1---------------1-------------1111-----111------------------1------------------------------------------------1-111-1- ---------------111-1-------11-111---11-1-11---1-111111----------11111---1-114522111111-1----1------------1--1-------------------------------------------------------------------11-1---111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 323 STR:RPRED 93.6 SQ:SECSTR ######################HHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHTTHHHHTTEEEEEccGGTTHHHHcccTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEcccEEEEEcTTEcccccGGGGTTcEEEEcHHHHHHHHTccTTGGGccHHHHHHHHTTHHHHHHHHHHHHHTTcEEEEEHHHHHHHHTTTcEEcccGGGcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTcHTccHHHHHHHcccHcTTGGGcccccccHHHHHHHHHHHHHHHHTTHHHTTTcTcccccccHHHHccHHHHHTTc DISOP:02AL 1-2, 27-34, 344-345| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHccccEEEEEcHHHHHHHHHccccEEEEEEEEccccEEEEEEEcccccccHHHHcccEEEEccccHHHHHHHHHHHHcccccccEEEEccHHHHHHHHcccEEEEEEEccHHHHHHHHcccccEEEEEccccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHccccccccccc //