[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ssuA2
DDBJ      :ssuA2        putative ABC transporter substrate-binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  304/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->315 3e4rA PDBj 5e-40 38.1 %
:RPS:PDB   40->325 2de3B PDBj 8e-32 14.4 %
:RPS:SCOP  39->319 1dioA  c.1.19.3 * 1e-26 10.6 %
:HMM:SCOP  38->265 1xs5A_ c.94.1.1 * 6.8e-48 35.3 %
:RPS:PFM   73->258 PF09084 * NMT1 8e-14 36.1 %
:HMM:PFM   80->257 PF09084 * NMT1 1.6e-17 25.1 175/216  
:BLT:SWISS 42->316 SSUA_ECOLI 2e-43 39.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69271.1 GT:GENE ssuA2 GT:PRODUCT putative ABC transporter substrate-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1921845..1922873 GB:FROM 1921845 GB:TO 1922873 GB:DIRECTION + GB:GENE ssuA2 GB:PRODUCT putative ABC transporter substrate-binding protein GB:NOTE sulfonate/nitrate/taurine transport system substrate-binding, PF03180: NLPA lipoprotein GB:PROTEIN_ID BAC69271.1 LENGTH 342 SQ:AASEQ MRRRLAPALLLPFPLLLAACGGNSAAGTSTGGRTDGKGSLTLNVGDQKGGSEAVLRAAGELKNLNYKIKWSTFTSGPPLLEAINAKAVDIGGVGNTPPVFAAGAGSKISVVAAWHGTSKGEAVLVPKNSSLRKPEELKGKSVAVAQGSSAHYQLVASLEKAGLKLSDVKVKYLQPADALAAFTSGKVDAWAVWDPYTSQVLQAKQGRALVDGDGVVNGLSFQVAAPSALADKKKSAAVKDYLERLRRAQDWVYEHPAAWAKVWAKDTGLPYEVALASVKRTNASRVPVAVDKPLIASEQQIADTFTGLKLIPKKVDFADFVDTRFNGGLPASTSTPRVYKDS GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 42->316|SSUA_ECOLI|2e-43|39.5|271/319| SEG 2->36|rrrlapalllpfplllaacggnsaagtstggrtdg| BL:PDB:NREP 1 BL:PDB:REP 42->315|3e4rA|5e-40|38.1|268/291| RP:PDB:NREP 1 RP:PDB:REP 40->325|2de3B|8e-32|14.4|284/347| RP:PFM:NREP 1 RP:PFM:REP 73->258|PF09084|8e-14|36.1|183/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 80->257|PF09084|1.6e-17|25.1|175/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 39->319|1dioA|1e-26|10.6|274/551|c.1.19.3| HM:SCP:REP 38->265|1xs5A_|6.8e-48|35.3|224/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 836 OP:NHOMOORG 310 OP:PATTERN ---------------------------------1---------1---11----1-------------- ----2---111---322----1---5------21114352-21221---11-22---1--------13141-------------------------------------------------------------------------1-------1----1-1--1----6-5--------------1------1-11111111111111114-11-111-1-3-----------3------------------------11---------21----1---------------------------------------11---111-----1-----------211-----1--------11-11----1----------111------8575B-214-12211111111111-9848827A-31-84451-23523265-----2-2--1--11111111----11----------------------------------1-1-42226BBAB5322218876333312A6A6462--552-22--441291-6--2-11-----------1-1-2--------1--1-33111-2-------5-----1-----------------------1-----1---1------------------1-------------3211-222222221222-222222222222222222255522-------------------22222222--122122212222---------------------------------5554524---E187382578377331776----------------------11--2--------------3------------------------------------------------------2 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 87.7 SQ:SECSTR ######################################TccEEEEEEEcccccHHHHTTHHHHTTEEEEEccGGGTTHHHHcccTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEccccEEEEEcTTcccccGGGGTTcEEEEcHHHHHHHHHHHHHHHTTccGGGcEEEEcccTTTccHHHHTcccEEEEEHHHHHHHHTTTcEEcccGGGcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTccHHHHHHHHcTTGGGcccccccHHHHHHHHHHHHHHHHTTcccccccHHHHccHHHccEETTccccHHH#### DISOP:02AL 336-342| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEEEEcccccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc //